CX288495

Overview
NameCX288495
Unique NameCX288495
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length594
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C77A3_SOYBN (Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.102e-44
Identity = 91/198 (45.96%), Postives = 133/198 (67.17%), Query Frame = 2
Query:    2 ILKDVMLITSPQLPDFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQL-GEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHVEFYT 592
            ++K V++   P++ D+LPIL+P F +Q ++A E+R+ Q+E LVP+I  R+  +   QNP S+    +    +Y+D+LF L+  G++    + E+V+LCSE ++ GTDT+AT  EW +  L+ N  +Q KLY+EI   VG+   V E+DVEKMPYL AVVKE LR+HPP HF+L+HA  + T LGGY IP   +VE YT
Sbjct:  213 VMKSVLITLDPRIDDYLPILSPFFSKQRKKALEVRREQVEFLVPIIEQRRRAI---QNPGSDHTATT---FSYLDTLFDLKVEGKKSAPSDAELVSLCSEFLNGGTDTTATAVEWGIAQLIANPNVQTKLYEEIKRTVGEKK-VDEKDVEKMPYLHAVVKELLRKHPPTHFVLTHAVTEPTTLGGYDIPIDANVEVYT 403          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C77A2_SOLME (Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 5.120e-42
Identity = 86/197 (43.65%), Postives = 130/197 (65.99%), Query Frame = 2
Query:    2 ILKDVMLITSPQLPDFLPILTPLFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQ-EIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHVEFY 589
            ++K V++   P+L D+LPIL+P F +Q + A ++RK+Q++ +VP I  RK  +E  +   + +        +Y+D+LF L+  GR       E+VTLCSE ++ GTDT+AT  EWA+  L+ N  IQ +LY+EI   VG++  + E+D+EKMPYL+AVVKE LR+HPP +  L+HA  +  +LGGY IP GV+VE +
Sbjct:  218 MMKSVLIALDPRLDDYLPILSPFFSKQRKHAMDVRKQQIKTIVPFIEQRKKILESPEIDKTAASF------SYLDTLFDLKIEGRNSTPTYPELVTLCSEFLNGGTDTTATAIEWAIGRLIENPNIQSQLYEEIKKTVGENK-IDEKDIEKMPYLNAVVKELLRKHPPTYMSLTHAVTEPAKLGGYDIPTGVNVEIF 407          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C77A1_SOLME (Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 5.660e-41
Identity = 93/199 (46.73%), Postives = 131/199 (65.83%), Query Frame = 2
Query:    2 ILKDVMLITSPQLPDFLPILTPLF--RRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQ-LGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHVEFY 589
            ++KDV+++  P++ DFLPIL  LF   +Q +   E+RKRQ+E LVPLI  R++ V   QNP S+    S    +Y+D+LF ++  GR+      E+VTLCSE ++ GTDT+AT  EW +  L+ N  IQ +LY+EI   VG D  V E D+EKMPYL+AVVKE LR+HPP +F L+H+  +  +L GY IP   +VEF+
Sbjct:  204 MMKDVLIVLDPRIDDFLPILR-LFVGYKQRKRVNEVRKRQIETLVPLIEKRRSVV---QNPGSDKTAAS---FSYLDTLFDVKVEGRKSGPTNAELVTLCSEFLNGGTDTTATALEWGIGRLMENPTIQNQLYQEIKTIVG-DKKVDENDIEKMPYLNAVVKELLRKHPPTYFTLTHSVTEPVKLAGYDIPMDTNVEFF 394          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C89A2_ARATH (Cytochrome P450 89A2 OS=Arabidopsis thaliana GN=CYP89A2 PE=2 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 2.629e-38
Identity = 84/175 (48.00%), Postives = 118/175 (67.43%), Query Frame = 2
Query:   68 LFRRQMREAKELRKRQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLE-PTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGL-VKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHVEF 586
            + R++ +E  ++R++Q + L+PLIR R+  VE  +   SE E       +YVD+L  LE P    +L E++I+ LCSE ++AGTDT+AT  +W M +LV   EIQE+L++EI + VG++   V+EEDVEKMPYL AVV E LRRHPPGHFLL H+  +DT LGGY +P    + F
Sbjct:  227 ILRKRWQEFLQIRRQQRDVLLPLIRARRKIVE--ERKRSEQEDKKDYVQSYVDTLLDLELPEENRKLNEEDIMNLCSEFLTAGTDTTATALQWIMANLVKYPEIQERLHEEIKSVVGEEAKEVEEEDVEKMPYLKAVVLEGLRRHPPGHFLLPHSVTEDTVLGGYKVPKNGTINF 399          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C98A1_SORBI (Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 3.450e-22
Identity = 52/121 (42.98%), Postives = 78/121 (64.46%), Query Frame = 2
Query:  218 YVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAGVHV 580
            +VD+LF L+   +  L E  ++ L  ++I+AG DT+  + EWAM  LV N  +Q+KL +E+   VG+D ++ E D + +PYL AVVKE+LR HPP   +L H A  + ++GGY IP G +V
Sbjct:  274 FVDALFTLKQ--QYDLSEDTVIGLLWDMITAGMDTTVISVEWAMAELVRNPRVQKKLQEELDRVVGRDRVMLETDFQNLPYLQAVVKESLRLHPPTPLMLPHKASTNVKIGGYDIPKGANV 392          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C78AB_ORYSJ (Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 1.712e-21
Identity = 64/157 (40.76%), Postives = 86/157 (54.78%), Query Frame = 2
Query:  110 RQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELG---GYSIPAG 571
            R+   LVP ++     V +      +S   +   A +VD L  LE    E L E ++V +  E+I  GTDT+A   EW M  +V N  +Q +L  E+ AAVG DG   + DV +MPYL AVVKETLR HPPG  LLS A +   ++G   G  +PAG
Sbjct:  286 RRCAALVPRVQAFVRGVIRDHRLRRDSSSTAADNADFVDVLLSLE--AHENLAEDDMVAVLWEMIFRGTDTTALVTEWCMAEVVRNPAVQARLRAEVDAAVGGDGCPSDGDVARMPYLQAVVKETLRAHPPGP-LLSWARLATADVGLANGMVVPAG 439          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C98A3_ARATH (Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.982e-21
Identity = 52/126 (41.27%), Postives = 77/126 (61.11%), Query Frame = 2
Query:  218 YVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAG--VHVEFY 589
            +VD+L  L+   +  L E  I+ L  ++I+AG DT+A TAEWAM  ++ N  +Q+K+ +E    VG D ++ E D  ++PYL  VVKE+ R HPP   +L H +  D ++GGY IP G  VHV  +
Sbjct:  271 FVDALLTLKD--QYDLSEDTIIGLLWDMITAGMDTTAITAEWAMAEMIKNPRVQQKVQEEFDRVVGLDRILTEADFSRLPYLQCVVKESFRLHPPTPLMLPHRSNADVKIGGYDIPKGSNVHVNVW 394          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C78A4_PINRA (Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 7.194e-20
Identity = 55/136 (40.44%), Postives = 79/136 (58.09%), Query Frame = 2
Query:  170 QNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFL-LSHAAIKDTELG-GYSIPAG 571
            Q+   E    S     +VD L  L+  G ++L E++++ +  E+I  GTDT+A   EW M  LVL+ E Q+K   E+ A VG D  VK+ D+ K+PY+ AVVKE LR HPPG  L  +  + +D  +G G  +PAG
Sbjct:  302 QHRREEQRRESGDQCDFVDVLLSLQ--GEDKLDEEDMIAVLWEMIFRGTDTTALLTEWTMAELVLHPEAQKKAQAELDAVVGHDRSVKDSDIPKLPYIQAVVKEALRMHPPGPLLSWARLSTEDVNMGDGMCVPAG 435          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C78A1_MAIZE (Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.093e-19
Identity = 60/157 (38.22%), Postives = 85/157 (54.14%), Query Frame = 2
Query:  110 RQMECLVPLIRNRKAFVEKGQNPNSESEMVSPIGAAYVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTEL---GGYSIPAG 571
            R+   LVP ++     V        ++       A +VD L  LE  G E+LG+ ++V +  E++  GTDT+A   EW M  LV +  +Q ++  E+ AAVG  G   + DV +MPYL AVVKETLR HPPG  LLS A +   ++    G  +PAG
Sbjct:  281 RRCAALVPRVQTFVRGVIDEHRRRRQNSAALNDNADFVDVLLSLE--GDEKLGDDDMVAILWEMVFRGTDTTALLTEWCMAELVRHPAVQARVRAEVDAAVGAGGCPTDADVARMPYLQAVVKETLRAHPPGP-LLSWARLATADVPLCNGMVVPAG 434          
BLAST of CX288495 vs. ExPASy Swiss-Prot
Match: C98A2_SOYBN (Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 3.570e-19
Identity = 48/126 (38.10%), Postives = 75/126 (59.52%), Query Frame = 2
Query:  218 YVDSLFGLEPTGREQLGEQEIVTLCSEVISAGTDTSATTAEWAMHHLVLNQEIQEKLYKEIVAAVGKDGLVKEEDVEKMPYLDAVVKETLRRHPPGHFLLSHAAIKDTELGGYSIPAG--VHVEFY 589
            +VD+L  L+   +  L E  I+ L  ++I+AG DT+A + EWAM  L+ N  +Q+K+ +E+   +G + ++ E D   +PYL  V KE +R HPP   +L H A  + ++GGY IP G  VHV  +
Sbjct:  272 FVDALLTLQD--KYDLSEDTIIGLLWDMITAGMDTTAISVEWAMAELIRNPRVQQKVQEELDRVIGLERVMTEADFSNLPYLQCVTKEAMRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVW 395          
The following BLAST results are available for this feature:
BLAST of CX288495 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 193
Match NameE-valueIdentityDescription
C77A3_SOYBN1.102e-4445.96Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=... [more]
C77A2_SOLME5.120e-4243.65Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77... [more]
C77A1_SOLME5.660e-4146.73Cytochrome P450 77A1 (Fragment) OS=Solanum melonge... [more]
C89A2_ARATH2.629e-3848.00Cytochrome P450 89A2 OS=Arabidopsis thaliana GN=CY... [more]
C98A1_SORBI3.450e-2242.98Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1... [more]
C78AB_ORYSJ1.712e-2140.76Cytochrome P450 78A11 OS=Oryza sativa subsp. japon... [more]
C98A3_ARATH4.982e-2141.27Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CY... [more]
C78A4_PINRA7.194e-2040.44Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 P... [more]
C78A1_MAIZE2.093e-1938.22Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 S... [more]
C98A2_SOYBN3.570e-1938.10Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02001A10SK IF1 Citrus clementina cDNA clone C02001A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288495 ID=CX288495|Name=CX288495|organism=Citrus clementina|type=EST|length=594bp
CATACTAAAAGATGTAATGCTGATAACATCACCACAGCTTCCGGATTTCT
TGCCGATTCTCACTCCATTATTTCGCAGGCAAATGAGAGAAGCAAAGGAG
TTGAGGAAGAGACAAATGGAGTGCTTGGTTCCACTGATAAGGAACAGAAA
AGCTTTTGTAGAGAAAGGCCAAAACCCTAACTCAGAGTCAGAGATGGTGA
GTCCAATTGGTGCTGCTTATGTGGATTCATTGTTTGGGCTGGAGCCAACG
GGGAGAGAGCAGCTGGGGGAACAAGAGATTGTGACATTGTGTTCTGAAGT
GATCAGTGCAGGCACTGACACTAGCGCAACAACGGCCGAATGGGCAATGC
ATCACTTGGTGCTAAACCAGGAGATTCAAGAAAAGTTGTATAAAGAAATT
GTAGCTGCTGTGGGGAAAGATGGGCTTGTTAAAGAAGAAGATGTCGAGAA
AATGCCTTATCTCGATGCTGTCGTGAAGGAAACTCTCCGGCGGCACCCTC
CTGGCCATTTTCTGCTGTCTCACGCTGCCATAAAGGATACTGAGCTTGGC
GGGTACTCCATCCCGGCAGGTGTTCACGTGGAATTCTACACTGC
back to top