CX288509

Overview
NameCX288509
Unique NameCX288509
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length617
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig69 contig Ccv1_Contig69:521..1137. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX288509 vs. ExPASy Swiss-Prot
Match: 2ABB_ORYSJ (Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Oryza sativa subsp. japonica GN=Os02g0224200 PE=2 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 1.869e-90
Identity = 161/203 (79.31%), Postives = 176/203 (86.70%), Query Frame = 1
Query:    1 MRQSALCDTHSKLFEEQEAPGTRSFFTEIIASISDIKFARNGRHILSRDYMTLKLWDINMDSGPVATFQVHEHLRPKLCDLYENDSIFDKFECCLSGDGGRVATGSYSNLFRVFGCSEGSAESTTLEASKNPMRRQVQTXXXXXXXXXXXXXVVRRVKGADNSALDANGNAFDFSMKLLHLAWHPSENSIACAASNSLYMYYA 609
            +RQSALCD H+KLFEE EAPG+RSFFTEIIAS+SDIKFAR+GRHILSRDYMTLKLWDINMDSGPVATFQVHE+LRPKLCDLYENDSIFDKFECCLSGDG RVATGSYSNLFRVFGC+ GSAE+TTLEAS+NPMRRQV                VRR  G +N  +DANGN++D S KLLHLAWHP+ENSIACAA+NSLYMYYA
Sbjct:  325 LRQSALCDNHAKLFEEHEAPGSRSFFTEIIASVSDIKFARDGRHILSRDYMTLKLWDINMDSGPVATFQVHEYLRPKLCDLYENDSIFDKFECCLSGDGLRVATGSYSNLFRVFGCTPGSAEATTLEASRNPMRRQVANPTRPARTLTSLTRAVRR--GGENPGVDANGNSYDLSTKLLHLAWHPTENSIACAAANSLYMYYA 525          
BLAST of CX288509 vs. ExPASy Swiss-Prot
Match: 2ABB_ORYSI (Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Oryza sativa subsp. indica GN=OsI_006296 PE=2 SV=2)

HSP 1 Score: 331.643 bits (849), Expect = 1.869e-90
Identity = 161/203 (79.31%), Postives = 176/203 (86.70%), Query Frame = 1
Query:    1 MRQSALCDTHSKLFEEQEAPGTRSFFTEIIASISDIKFARNGRHILSRDYMTLKLWDINMDSGPVATFQVHEHLRPKLCDLYENDSIFDKFECCLSGDGGRVATGSYSNLFRVFGCSEGSAESTTLEASKNPMRRQVQTXXXXXXXXXXXXXVVRRVKGADNSALDANGNAFDFSMKLLHLAWHPSENSIACAASNSLYMYYA 609
            +RQSALCD H+KLFEE EAPG+RSFFTEIIAS+SDIKFAR+GRHILSRDYMTLKLWDINMDSGPVATFQVHE+LRPKLCDLYENDSIFDKFECCLSGDG RVATGSYSNLFRVFGC+ GSAE+TTLEAS+NPMRRQV                VRR  G +N  +DANGN++D S KLLHLAWHP+ENSIACAA+NSLYMYYA
Sbjct:  325 LRQSALCDNHAKLFEEHEAPGSRSFFTEIIASVSDIKFARDGRHILSRDYMTLKLWDINMDSGPVATFQVHEYLRPKLCDLYENDSIFDKFECCLSGDGLRVATGSYSNLFRVFGCTPGSAEATTLEASRNPMRRQVANPTRPARTLTSLTRAVRR--GGENPGVDANGNSYDLSTKLLHLAWHPTENSIACAAANSLYMYYA 525          
BLAST of CX288509 vs. ExPASy Swiss-Prot
Match: 2ABB_ARATH (Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Arabidopsis thaliana GN=PP2AB2 PE=2 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 6.011e-89
Identity = 157/203 (77.34%), Postives = 179/203 (88.18%), Query Frame = 1
Query:    1 MRQSALCDTHSKLFEEQEAPGTRSFFTEIIASISDIKFARNGRHILSRDYMTLKLWDINMDSGPVATFQVHEHLRPKLCDLYENDSIFDKFECCLSGDGGRVATGSYSNLFRVFGCSEGSAESTTLEASKNPMRRQVQTXXXXXXXXXXXXXVVRRVKGADNSALDANGNAFDFSMKLLHLAWHPSENSIACAASNSLYMYYA 609
            MRQSALCD+H+KLFEE EAPG+RSFFTEIIASISDIKF+++GR+ILSRDYMTLKLWDINMDSGPVA++QVHEHLRP+LCDLYENDSIFDKFECCLSGDG RVATGSYSNLFRVFG S+GS E+ TLEASKNPMRRQ+QT             VVRR  G+++   +ANGNA+DF+ KLLH+AWHP+ENSIACAA+NSLYMYYA
Sbjct:  301 MRQSALCDSHTKLFEEPEAPGSRSFFTEIIASISDIKFSKDGRYILSRDYMTLKLWDINMDSGPVASYQVHEHLRPRLCDLYENDSIFDKFECCLSGDGLRVATGSYSNLFRVFGASQGSTEAATLEASKNPMRRQIQTPARPSRSIGSMTRVVRR--GSESPGTEANGNAYDFTTKLLHMAWHPTENSIACAAANSLYMYYA 501          
BLAST of CX288509 vs. ExPASy Swiss-Prot
Match: 2ABA_ORYSJ (Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Oryza sativa subsp. japonica GN=Os06g0563300 PE=2 SV=2)

HSP 1 Score: 326.25 bits (835), Expect = 7.851e-89
Identity = 157/203 (77.34%), Postives = 174/203 (85.71%), Query Frame = 1
Query:    1 MRQSALCDTHSKLFEEQEAPGTRSFFTEIIASISDIKFARNGRHILSRDYMTLKLWDINMDSGPVATFQVHEHLRPKLCDLYENDSIFDKFECCLSGDGGRVATGSYSNLFRVFGCSEGSAESTTLEASKNPMRRQVQTXXXXXXXXXXXXXVVRRVKGADNSALDANGNAFDFSMKLLHLAWHPSENSIACAASNSLYMYYA 609
            +RQSALCD HSK+FEE EAPG+RSFFTEIIASISDIKF+R+GR+ILSRDYMTLKLWD+NMDSGPV+TFQVHEHLRPKLCDLYENDSIFDKFECCLSGDG  VATGSY NLFRVFGC+ GS E+TTLEAS+NPMRRQ+                VRR  G +N  +DANGN+FDFS KLLHLAWHP+ENSIACAA+NSLYMYYA
Sbjct:  322 LRQSALCDNHSKIFEEHEAPGSRSFFTEIIASISDIKFSRDGRYILSRDYMTLKLWDLNMDSGPVSTFQVHEHLRPKLCDLYENDSIFDKFECCLSGDGLHVATGSYGNLFRVFGCTPGSTEATTLEASRNPMRRQIVNPTRPTRTLTSLARGVRR--GGENQGVDANGNSFDFSTKLLHLAWHPTENSIACAAANSLYMYYA 522          
BLAST of CX288509 vs. ExPASy Swiss-Prot
Match: 2ABA_ARATH (Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Arabidopsis thaliana GN=PP2AB1 PE=1 SV=2)

HSP 1 Score: 298.13 bits (762), Expect = 2.290e-80
Identity = 144/203 (70.94%), Postives = 167/203 (82.27%), Query Frame = 1
Query:    1 MRQSALCDTHSKLFEEQEAPGTRSFFTEIIASISDIKFARNGRHILSRDYMTLKLWDINMDSGPVATFQVHEHLRPKLCDLYENDSIFDKFECCLSGDGGRVATGSYSNLFRVFGCSEGSAESTTLEASKNPMRRQVQTXXXXXXXXXXXXXVVRRVKGADNSALDANGNAFDFSMKLLHLAWHPSENSIACAASNSLYMYYA 609
            +RQSALCD+HSKLFEE E  G +SFFTEIIAS+SDIKFA+ GR++LSRDYMTLKLWDINMD+GPVATFQVHE+L+PKLCDLYENDSIFDKFECC+SG+G R ATGSYSNLFRVFG + GS E+ TLEAS+NPMRR V               VV R  G+++  +D N NA D++ KLLHLAWHP+ENSIACAA+NSLYMYYA
Sbjct:  313 LRQSALCDSHSKLFEEPEQAGPKSFFTEIIASVSDIKFAKEGRYLLSRDYMTLKLWDINMDAGPVATFQVHEYLKPKLCDLYENDSIFDKFECCISGNGLRAATGSYSNLFRVFGVAPGSTETATLEASRNPMRRHVPIPSRPSRALSSITRVVSR--GSESPGVDGNTNALDYTTKLLHLAWHPNENSIACAAANSLYMYYA 513          
BLAST of CX288509 vs. ExPASy Swiss-Prot
Match: PH2AB_DICDI (Serine/threonine-protein phosphatase 2A regulatory subunit phr2AB OS=Dictyostelium discoideum GN=phr2AB PE=3 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.020e-52
Identity = 100/203 (49.26%), Postives = 137/203 (67.49%), Query Frame = 1
Query:    1 MRQSALCDTHSKLFEEQEAPGTRSFFTEIIASISDIKFARNGRHILSRDYMTLKLWDINMDSGPVATFQVHEHLRPKLCDLYENDSIFDKFECCLSGDGGRVATGSYSNLFRVFGCSEGSAESTTLEASKNPMRRQVQTXXXXXXXXXXXXXVVRRVKGADNSALDANGNAFDFSMKLLHLAWHPSENSIACAASNSLYMYYA 609
            +R SALCD H+K+FEE E P  +SFF+EII+SISDIKF+R+GR+ILSRD++TLKLWDINM++ PV T Q+H++L+PKLCDLYEND IFDKFEC L+ DG ++ TGSY N   ++     S +   LEASK   + + +T              +R  K       D + +A +++ K LH AWHP +N IA  A+N++Y+Y A
Sbjct:  287 LRSSALCDNHAKVFEEYEDPSNKSFFSEIISSISDIKFSRDGRYILSRDFLTLKLWDINMENKPVKTIQIHDYLKPKLCDLYENDCIFDKFECTLNHDGTQMLTGSYHNYLHIY--DRNSKQDVCLEASKQATKSKTKTLTTKMK--------LRSSKKEPKKPEDIHPDAIEYTKKTLHCAWHPKDNLIAVGAANTVYLYAA 479          
BLAST of CX288509 vs. ExPASy Swiss-Prot
Match: 2ABD_CHICK (Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Gallus gallus GN=PPP2R2D PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 5.877e-52
Identity = 100/202 (49.50%), Postives = 137/202 (67.82%), Query Frame = 1
Query:    1 MRQSALCDTHSKLFEEQEAPGTRSFFTEIIASISDIKFARNGRHILSRDYMTLKLWDINMDSGPVATFQVHEHLRPKLCDLYENDSIFDKFECCLSGDGGRVATGSYSNLFRVFGCSEGSAESTTLEASKNPMRRQVQTXXXXXXXXXXXXXVVRRV-KGADNSALDANGNAFDFSMKLLHLAWHPSENSIACAASNSLYMY 603
            MR SALCD HSK FEE E P +RSFF+EII+SISD+KF+ +GR++++RDY+++K+WD+NM++ PV T+QVHE+LR KLC LYEND IFDKFECC +G  G + TGSY+N FR+F     +    TLEAS+   + +                  R+V  G      + N ++ DF+ K+LH AWHP EN IA AA+N+LY++
Sbjct:  260 MRSSALCDRHSKFFEEPEDPSSRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKVWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDGAIMTGSYNNFFRMF--DRNTRRDITLEASRESSKPRA-------------ILKPRKVCTGGKRKKDEINVDSLDFNKKILHTAWHPMENIIAVAATNNLYIF 446          
BLAST of CX288509 vs. ExPASy Swiss-Prot
Match: 2ABB_XENTR (Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Xenopus tropicalis GN=ppp2r2b PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.890e-50
Identity = 100/201 (49.75%), Postives = 134/201 (66.67%), Query Frame = 1
Query:    1 MRQSALCDTHSKLFEEQEAPGTRSFFTEIIASISDIKFARNGRHILSRDYMTLKLWDINMDSGPVATFQVHEHLRPKLCDLYENDSIFDKFECCLSGDGGRVATGSYSNLFRVFGCSEGSAESTTLEASKNPMRRQVQTXXXXXXXXXXXXXVVRRVKGADNSALDANGNAFDFSMKLLHLAWHPSENSIACAASNSLYMY 603
            MR SALCD HSKLFEE E P  RSFF+EII+SISD+KF  +GR+I++RDY+T+K+WD+NM++ P+ T+QVH++LR KLC LYEND IFDKFEC  +G    + TGSY+N FR+F     +    TLEAS+   + +                 V   +  D  ++D    + DFS K+LH AWHPSEN IA AA+N+LY++
Sbjct:  252 MRSSALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFNHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMF--DRNTKRDVTLEASRENSKPRA--------ILKPRKVCVGGKRRKDEISVD----SLDFSKKILHTAWHPSENIIAVAATNNLYIF 438          
BLAST of CX288509 vs. ExPASy Swiss-Prot
Match: 2ABB_XENLA (Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Xenopus laevis GN=ppp2r2b PE=2 SV=2)

HSP 1 Score: 198.749 bits (504), Expect = 1.890e-50
Identity = 100/201 (49.75%), Postives = 134/201 (66.67%), Query Frame = 1
Query:    1 MRQSALCDTHSKLFEEQEAPGTRSFFTEIIASISDIKFARNGRHILSRDYMTLKLWDINMDSGPVATFQVHEHLRPKLCDLYENDSIFDKFECCLSGDGGRVATGSYSNLFRVFGCSEGSAESTTLEASKNPMRRQVQTXXXXXXXXXXXXXVVRRVKGADNSALDANGNAFDFSMKLLHLAWHPSENSIACAASNSLYMY 603
            MR SALCD HSKLFEE E P  RSFF+EII+SISD+KF  +GR+I++RDY+T+K+WD+NM++ P+ T+QVH++LR KLC LYEND IFDKFEC  +G    + TGSY+N FR+F     +    TLEAS+   + +                 V   +  D  ++D    + DFS K+LH AWHPSEN IA AA+N+LY++
Sbjct:  277 MRSSALCDKHSKLFEEPEDPSNRSFFSEIISSISDVKFNHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMF--DRNTKRDVTLEASRENSKPRA--------ILKPRKVCVGGKRRKDEISVD----SLDFSKKILHTAWHPSENIIAVAATNNLYIF 463          
BLAST of CX288509 vs. ExPASy Swiss-Prot
Match: 2ABD_HUMAN (Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Homo sapiens GN=PPP2R2D PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 2.469e-50
Identity = 98/202 (48.51%), Postives = 135/202 (66.83%), Query Frame = 1
Query:    1 MRQSALCDTHSKLFEEQEAPGTRSFFTEIIASISDIKFARNGRHILSRDYMTLKLWDINMDSGPVATFQVHEHLRPKLCDLYENDSIFDKFECCLSGDGGRVATGSYSNLFRVFGCSEGSAESTTLEASKNPMRRQVQTXXXXXXXXXXXXXVVRRV-KGADNSALDANGNAFDFSMKLLHLAWHPSENSIACAASNSLYMY 603
            MR SALCD HSK FEE E P +RSFF+EII+SISD+KF+ +GR++++RDY+++K+WD+NM+S PV T QVHE+LR KLC LYEND IFDKFECC +G    + TGSY+N FR+F     +    TLEAS+   + +                  R+V  G      + + ++ DF+ K+LH AWHP +N IA AA+N+LY++
Sbjct:  262 MRSSALCDRHSKFFEEPEDPSSRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKVWDLNMESRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSAIMTGSYNNFFRMF--DRDTRRDVTLEASRESSKPRASLKP-------------RKVCTGGKRRKDEISVDSLDFNKKILHTAWHPVDNVIAVAATNNLYIF 448          
The following BLAST results are available for this feature:
BLAST of CX288509 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
2ABB_ORYSJ1.869e-9079.31Serine/threonine protein phosphatase 2A 55 kDa reg... [more]
2ABB_ORYSI1.869e-9079.31Serine/threonine protein phosphatase 2A 55 kDa reg... [more]
2ABB_ARATH6.011e-8977.34Serine/threonine protein phosphatase 2A 55 kDa reg... [more]
2ABA_ORYSJ7.851e-8977.34Serine/threonine protein phosphatase 2A 55 kDa reg... [more]
2ABA_ARATH2.290e-8070.94Serine/threonine protein phosphatase 2A 55 kDa reg... [more]
PH2AB_DICDI2.020e-5249.26Serine/threonine-protein phosphatase 2A regulatory... [more]
2ABD_CHICK5.877e-5249.50Serine/threonine-protein phosphatase 2A 55 kDa reg... [more]
2ABB_XENTR1.890e-5049.75Serine/threonine-protein phosphatase 2A 55 kDa reg... [more]
2ABB_XENLA1.890e-5049.75Serine/threonine-protein phosphatase 2A 55 kDa reg... [more]
2ABD_HUMAN2.469e-5048.51Serine/threonine-protein phosphatase 2A 55 kDa reg... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02001C01SK IF1 Citrus clementina cDNA clone C02001C01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288509 ID=CX288509|Name=CX288509|organism=Citrus clementina|type=EST|length=617bp
ATGCGGCAGTCAGCTTTATGCGATACTCATAGCAAATTGTTTGAGGAACA
GGAAGCTCCCGGTACGAGGTCTTTTTTCACGGAGATAATTGCCTCCATTT
CAGATATCAAGTTTGCCAGGAATGGAAGACATATATTAAGTCGTGACTAC
ATGACCCTCAAGTTATGGGACATAAATATGGATTCTGGTCCTGTTGCAAC
TTTCCAGGTTCATGAACATCTAAGACCTAAGTTGTGTGATTTATATGAAA
ATGATTCTATCTTTGACAAATTTGAGTGTTGTCTGAGCGGAGATGGGGGT
CGGGTGGCTACTGGTTCCTACAGCAATCTGTTTCGCGTGTTTGGTTGTTC
TGAGGGTAGTGCAGAATCAACAACACTGGAAGCCAGCAAAAATCCCATGA
GGAGACAAGTTCAAACCCCGTCAAGGCCTTCTAGACCTCTAGGAAGTCTT
TCTGGTGTTGTGAGGCGAGTAAAAGGAGCAGATAACTCTGCACTTGATGC
AAATGGAAATGCTTTTGATTTCTCCATGAAGTTGTTGCACTTAGCTTGGC
ATCCATCAGAAAACTCAATTGCATGCGCTGCTTCAAACAGCCTTTACATG
TATTATGCATAAAGTTG
back to top