CX288511

Overview
NameCX288511
Unique NameCX288511
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length274
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:1179..1452. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX288511 vs. ExPASy Swiss-Prot
Match: SAHH_TOBAC (Adenosylhomocysteinase OS=Nicotiana tabacum GN=SAHH PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.143e-43
Identity = 82/87 (94.25%), Postives = 86/87 (98.85%), Query Frame = -1
Query:    2 LDVLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPK 262
            +D+LGLETYPGVKRITIKPQTDRWVFP+TNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKS+GKYEKKVYVLPK
Sbjct:  355 IDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPK 441          
BLAST of CX288511 vs. ExPASy Swiss-Prot
Match: SAHH_NICSY (Adenosylhomocysteinase OS=Nicotiana sylvestris GN=SAHH PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.143e-43
Identity = 82/87 (94.25%), Postives = 86/87 (98.85%), Query Frame = -1
Query:    2 LDVLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPK 262
            +D+LGLETYPGVKRITIKPQTDRWVFP+TNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKS+GKYEKKVYVLPK
Sbjct:  355 IDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPK 441          
BLAST of CX288511 vs. ExPASy Swiss-Prot
Match: SAHH2_ARATH (Adenosylhomocysteinase 2 OS=Arabidopsis thaliana GN=SAHH2 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.143e-43
Identity = 82/87 (94.25%), Postives = 86/87 (98.85%), Query Frame = -1
Query:    2 LDVLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPK 262
            +D+LGLETYPGVKRITIKPQTDRWVFP+TNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKS+GKYEKKVYVLPK
Sbjct:  355 IDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPK 441          
BLAST of CX288511 vs. ExPASy Swiss-Prot
Match: SAHH_CATRO (Adenosylhomocysteinase OS=Catharanthus roseus GN=SAHH PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 2.547e-43
Identity = 81/87 (93.10%), Postives = 85/87 (97.70%), Query Frame = -1
Query:    2 LDVLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPK 262
            +D+LGLETYPGVKRITIKPQTDRWVFP+TNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TGKYEKKVYVLPK
Sbjct:  355 IDMLGLETYPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYEKKVYVLPK 441          
BLAST of CX288511 vs. ExPASy Swiss-Prot
Match: SAHH_LUPLU (Adenosylhomocysteinase OS=Lupinus luteus GN=SAHH PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 5.675e-43
Identity = 80/87 (91.95%), Postives = 86/87 (98.85%), Query Frame = -1
Query:    2 LDVLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPK 262
            +D+LGLET+PGVKRITIKPQTDRWVFPETN+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKS+GKYEKKVYVLPK
Sbjct:  355 IDMLGLETHPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPK 441          
BLAST of CX288511 vs. ExPASy Swiss-Prot
Match: SAHH1_ARATH (Adenosylhomocysteinase 1 OS=Arabidopsis thaliana GN=SAHH1 PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.264e-42
Identity = 80/87 (91.95%), Postives = 85/87 (97.70%), Query Frame = -1
Query:    2 LDVLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPK 262
            +D+LGLETYPGVKRITIKPQTDRWVFPET +GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPK
Sbjct:  355 IDMLGLETYPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPK 441          
BLAST of CX288511 vs. ExPASy Swiss-Prot
Match: SAHH_MEDSA (Adenosylhomocysteinase OS=Medicago sativa GN=SAHH PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.651e-42
Identity = 80/87 (91.95%), Postives = 85/87 (97.70%), Query Frame = -1
Query:    2 LDVLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPK 262
            +D+ GLETYPGVKRITIKPQTDRWVFPET SGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK++GKYEKKVYVLPK
Sbjct:  355 IDMHGLETYPGVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSGKYEKKVYVLPK 441          
BLAST of CX288511 vs. ExPASy Swiss-Prot
Match: SAHH_PETCR (Adenosylhomocysteinase OS=Petroselinum crispum GN=SAHH PE=2 SV=2)

HSP 1 Score: 170.244 bits (430), Expect = 2.817e-42
Identity = 79/87 (90.80%), Postives = 84/87 (96.55%), Query Frame = -1
Query:    2 LDVLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPK 262
            +D+LGLETYPGVKRITIKPQTDRWVFP+T  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKS+GKYEKKVYVLPK
Sbjct:  355 IDMLGLETYPGVKRITIKPQTDRWVFPDTGRGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPK 441          
BLAST of CX288511 vs. ExPASy Swiss-Prot
Match: SAHH_SOLLC (Adenosylhomocysteinase OS=Solanum lycopersicum GN=SAHH PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.804e-42
Identity = 79/87 (90.80%), Postives = 85/87 (97.70%), Query Frame = -1
Query:    2 LDVLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPK 262
            +D+ GLET+PGVKRITIKPQTDRWVFP+TNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+S+GKYEKKVYVLPK
Sbjct:  355 IDMHGLETFPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERSSGKYEKKVYVLPK 441          
BLAST of CX288511 vs. ExPASy Swiss-Prot
Match: SAHH_WHEAT (Adenosylhomocysteinase OS=Triticum aestivum GN=SAHH PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.195e-42
Identity = 79/87 (90.80%), Postives = 84/87 (96.55%), Query Frame = -1
Query:    2 LDVLGLETYPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPK 262
            +D+ GLETYPGVKRITIKPQTDRWVFPET +GIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GKYEKKVYVLPK
Sbjct:  355 IDMNGLETYPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPK 441          
The following BLAST results are available for this feature:
BLAST of CX288511 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 195
Match NameE-valueIdentityDescription
SAHH_TOBAC1.143e-4394.25Adenosylhomocysteinase OS=Nicotiana tabacum GN=SAH... [more]
SAHH_NICSY1.143e-4394.25Adenosylhomocysteinase OS=Nicotiana sylvestris GN=... [more]
SAHH2_ARATH1.143e-4394.25Adenosylhomocysteinase 2 OS=Arabidopsis thaliana G... [more]
SAHH_CATRO2.547e-4393.10Adenosylhomocysteinase OS=Catharanthus roseus GN=S... [more]
SAHH_LUPLU5.675e-4391.95Adenosylhomocysteinase OS=Lupinus luteus GN=SAHH P... [more]
SAHH1_ARATH1.264e-4291.95Adenosylhomocysteinase 1 OS=Arabidopsis thaliana G... [more]
SAHH_MEDSA1.651e-4291.95Adenosylhomocysteinase OS=Medicago sativa GN=SAHH ... [more]
SAHH_PETCR2.817e-4290.80Adenosylhomocysteinase OS=Petroselinum crispum GN=... [more]
SAHH_SOLLC4.804e-4290.80Adenosylhomocysteinase OS=Solanum lycopersicum GN=... [more]
SAHH_WHEAT8.195e-4290.80Adenosylhomocysteinase OS=Triticum aestivum GN=SAH... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02001C03SK IF1 Citrus clementina cDNA clone C02001C03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288511 ID=CX288511|Name=CX288511|organism=Citrus clementina|type=EST|length=274bp
GCTTGGGCAGAACATACACCTTCTTCTCGTACTTGCCGGTGCTCTTCTCC
TTCCAGAGCTCAAGCTGGGCAATCACCTGATTGGTGAAGGAACAGGACAT
CACAAAGCTGGGGTGCCCAGTGGCACATCCCAAGTTCATGAGACGTCCCT
CAGCCAACACGATGATGCCTGAGTTGGTCTCGGGGAAGACCCACCTATCA
GTTTGGGGCTTGATGGTAATGCGCTTAACACCCGGGTAGGTCTCAAGACC
GAGCACATCAAGGGGGGGCCCGGT
back to top