CX288514

Overview
NameCX288514
Unique NameCX288514
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length437
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig886 contig Ccv1_Contig886:78..514. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX288514 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.309e-16
Identity = 49/134 (36.57%), Postives = 78/134 (58.21%), Query Frame = 2
Query:   47 SEPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHLG--TNGQCPLDVIQLSSPSERGDNLRLLPYDNYK-IVKVSTDVNLRFPVKVSVKPCNEEPLWKVDSYDDPL----IVTGGSEGHPGAETLLNWFKIEKAG 427
            + PVLD  G+++++ ++Y ++  + GAGG    LG  T   CP  V+Q  S  + G  +     D+   +V+VSTDVN+ F V +  + C+   +W++D+YD+      + T G +G PG  TL +WFKIEKAG
Sbjct:   28 NSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEF-VPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAG 160          
BLAST of CX288514 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 81.2629 bits (199), Expect = 1.891e-15
Identity = 55/153 (35.95%), Postives = 82/153 (53.59%), Query Frame = 2
Query:    2 ILTLATQPLLGISSNS-EPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHLGT--NGQ--CPLDVIQLSSPSERGDNLRLLPYDNYK--IVKVSTDVNLRFPVKVSVKPCN--EEPLWKVDSYDDP----LIVTGGSEGHPGAETLLNWFKIEK 421
            +L  A  PLL  + ++  PVLDI G K+++   Y ++PVL   GG  T   T  NG   CP  V+Q     +    L   P +N K  +V+VSTD+N+ F    +  PC      +W++D YD+      +  GG +G+PG ET+ +WFKIE+
Sbjct:   17 LLAAAANPLLSAADSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFP-ENPKEDVVRVSTDLNINFS---AFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEE 165          
BLAST of CX288514 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 9.711e-12
Identity = 44/134 (32.84%), Postives = 72/134 (53.73%), Query Frame = 2
Query:   50 EPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHL---GTNGQCPLDVIQLSSPSERGDNLRLLPYDNYK--IVKVSTDVNLRFPVKVSVKPCNEEPLWKVDSYDDPL---IVTGGSEGHPGAETLLNWFKIEKAG 427
            +P++DI G  V   ++Y ++  + GAGG    +   G   +CPL V+Q   P + G+ +      N K  IV  S D+N++F + ++   CNE   WKVD +   +   +  GG +G+ G E+  + FKI+KAG
Sbjct:    4 KPIVDIDGKPVLYGVDYFVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQ--DPFDNGEPIIFSAIKNVKDNIVFESVDLNVKFNITIN---CNETTAWKVDRFPGVIGWTVTLGGEKGYHGFESTHSMFKIKKAG 132          
The following BLAST results are available for this feature:
BLAST of CX288514 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
ASP_THECC1.309e-1636.5721 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU1.891e-1535.95Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA9.711e-1232.84Latex serine proteinase inhibitor OS=Carica papaya... [more]
back to top
Properties
Property NameValue
Genbank descriptionC02001C07SK IF1 Citrus clementina cDNA clone C02001C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288514 ID=CX288514|Name=CX288514|organism=Citrus clementina|type=EST|length=437bp
TATCCTTACCTTGGCCACGCAGCCTCTATTGGGCATCTCATCAAACTCTG
AACCTGTCTTAGATATCATTGGCAACAAGGTCAAATCCACCCTCGAGTAT
AAACTTATCCCAGTCCTAGATGGCGCCGGTGGATTCAGCACACACCTAGG
CACAAATGGACAGTGTCCCTTGGACGTTATCCAATTAAGTTCTCCTAGCG
AAAGGGGAGATAATTTAAGATTACTTCCGTACGACAATTACAAAATTGTC
AAGGTATCCACTGATGTCAACCTGAGATTCCCCGTAAAAGTTTCTGTTAA
GCCCTGTAATGAAGAACCATTGTGGAAAGTTGATAGCTATGACGATCCAT
TAATTGTAACCGGCGGAAGTGAGGGCCACCCAGGAGCTGAAACGTTGCTA
AATTGGTTTAAGATTGAGAAAGCTGGAAATTTTTCAT
back to top