CX288518

Overview
NameCX288518
Unique NameCX288518
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length521
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig7340 contig Ccv1_Contig7340:1439..1959. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX288518 vs. ExPASy Swiss-Prot
Match: FTSH2_ORYSJ (Cell division protease ftsH homolog 2, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH2 PE=3 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 1.219e-88
Identity = 163/174 (93.68%), Postives = 169/174 (97.13%), Query Frame = 1
Query:    1 NLLNEAAILAGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVTTGAAGDLQQITGLAKQMVTTFGMSEIGPWSLMD-GSQSGDVIMRMMARNSM 519
            NLLNEAAILAGRRG+ AISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTL+PRGQARGLTWFIP DDPTLIS+QQLFARIVGGLGGRAAEE+IFG PEVTTGAAGDLQQITGLAKQMV TFGMS+IGPWSLMD G+QSGDVIMRMMARNSM
Sbjct:  425 NLLNEAAILAGRRGRTAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLIPRGQARGLTWFIPMDDPTLISRQQLFARIVGGLGGRAAEEIIFGEPEVTTGAAGDLQQITGLAKQMVVTFGMSDIGPWSLMDSGAQSGDVIMRMMARNSM 598          
BLAST of CX288518 vs. ExPASy Swiss-Prot
Match: FTSH8_ARATH (Cell division protease ftsH homolog 8, chloroplastic OS=Arabidopsis thaliana GN=FTSH8 PE=1 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 1.760e-87
Identity = 162/173 (93.64%), Postives = 164/173 (94.80%), Query Frame = 1
Query:    1 NLLNEAAILAGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVTTGAAGDLQQITGLAKQMVTTFGMSEIGPWSLMDGSQSGDVIMRMMARNSM 519
            NLLNEAAILAGRRGK AISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHD VQKVTL+PRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFG  EVTTGA  DLQQITGLAKQMVTTFGMSEIGPWSLMD S+  DVIMRMMARNSM
Sbjct:  431 NLLNEAAILAGRRGKTAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDAVQKVTLIPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGESEVTTGAVSDLQQITGLAKQMVTTFGMSEIGPWSLMDSSEQSDVIMRMMARNSM 603          
BLAST of CX288518 vs. ExPASy Swiss-Prot
Match: FTSH2_ARATH (Cell division protease ftsH homolog 2, chloroplastic OS=Arabidopsis thaliana GN=FTSH2 PE=1 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 1.261e-85
Identity = 156/173 (90.17%), Postives = 163/173 (94.22%), Query Frame = 1
Query:    1 NLLNEAAILAGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVTTGAAGDLQQITGLAKQMVTTFGMSEIGPWSLMDGSQSGDVIMRMMARNSM 519
            NLLNEAAILAGRR + +ISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHA+CGTLTPGHD VQKVTL+PRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEE+IFG  EVTTGA GDLQQITGLA+QMVTTFGMS+IGPWSLMD S   DVIMRMMARNSM
Sbjct:  438 NLLNEAAILAGRRARTSISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAVCGTLTPGHDAVQKVTLIPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEIIFGDSEVTTGAVGDLQQITGLARQMVTTFGMSDIGPWSLMDSSAQSDVIMRMMARNSM 610          
BLAST of CX288518 vs. ExPASy Swiss-Prot
Match: FTSH6_ARATH (Cell division protease ftsH homolog 6, chloroplastic OS=Arabidopsis thaliana GN=FTSH6 PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 3.114e-76
Identity = 139/174 (79.89%), Postives = 157/174 (90.23%), Query Frame = 1
Query:    1 NLLNEAAILAGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVTTGAAGDLQQITGLAKQMVTTFGMSEIGPWSLMDGS-QSGDVIMRMMARNSM 519
            NL+NEAAILAGRRGK  I+  EIDDSIDRIVAGMEGT M DGKSK++VAYHEVGHAIC TLT GHDPVQKVTLVPRGQARGLTWF+P +DPTL+SKQQLFARIVGGLGGRAAE+VIFG PE+TTGAAGDLQQ+T +A+QMVT FGMSEIGPW+L D + +  DV++RM+ARNSM
Sbjct:  435 NLMNEAAILAGRRGKDKITLTEIDDSIDRIVAGMEGTKMIDGKSKAIVAYHEVGHAICATLTEGHDPVQKVTLVPRGQARGLTWFLPGEDPTLVSKQQLFARIVGGLGGRAAEDVIFGEPEITTGAAGDLQQVTEIARQMVTMFGMSEIGPWALTDPAVKQNDVVLRMLARNSM 608          
BLAST of CX288518 vs. ExPASy Swiss-Prot
Match: FTSH6_ORYSJ (Cell division protease ftsH homolog 6, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH6 PE=3 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 2.728e-72
Identity = 132/175 (75.43%), Postives = 155/175 (88.57%), Query Frame = 1
Query:    1 NLLNEAAILAGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIP-SDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVTTGAAGDLQQITGLAKQMVTTFGMSEIGPWSLMD-GSQSGDVIMRMMARNSM 519
            NL+NEAAILAGRRGK  I+  EIDDSIDRIVAG+EGT MTDGKSK LVAYHE+GHA+C TLT GHD VQKVTL+PRGQARGLTWF+P  +DP L+S+QQ+FA IVGGLGGRAAEEV+FG PEVTTGAAGDLQQ+T +A++MVT FGMSEIGPW+L +  +Q GDV++RM+AR+SM
Sbjct:  433 NLMNEAAILAGRRGKDRITVSEIDDSIDRIVAGLEGTSMTDGKSKMLVAYHEIGHAVCATLTAGHDEVQKVTLIPRGQARGLTWFLPGEEDPALVSRQQIFAGIVGGLGGRAAEEVVFGEPEVTTGAAGDLQQVTRVARRMVTAFGMSEIGPWALAEPAAQGGDVVLRMLARSSM 607          
BLAST of CX288518 vs. ExPASy Swiss-Prot
Match: FSTH_PORYE (Cell division protease ftsH homolog OS=Porphyra yezoensis GN=ftsH PE=3 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 1.552e-59
Identity = 116/162 (71.60%), Postives = 132/162 (81.48%), Query Frame = 1
Query:    1 NLLNEAAILAGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVTTGAAGDLQQITGLAKQMVTTFGMSEIGPWSLMDGSQSGD 486
            NLLNEAAIL  RR K A++  EID SIDR+VAGMEGT + D KSK L+AYHEVGHAI G+L   HDPVQKVTL+PRGQARGLTWF PSDD +LIS+ Q+ ARIVG LGGRAAEE+IFG  EVTTGA+ DLQQ+T +A+QMVT FGMS+IGP SL   SQ GD
Sbjct:  384 NLLNEAAILTARRRKNAMTMSEIDTSIDRVVAGMEGTPLIDSKSKRLIAYHEVGHAIIGSLLEHHDPVQKVTLIPRGQARGLTWFTPSDDQSLISRSQILARIVGALGGRAAEEIIFGDAEVTTGASNDLQQVTSMARQMVTRFGMSKIGPLSL--ESQGGD 543          
BLAST of CX288518 vs. ExPASy Swiss-Prot
Match: FTSH_PORPU (Cell division protease ftsH homolog OS=Porphyra purpurea GN=ftsH PE=3 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 7.705e-59
Identity = 111/154 (72.08%), Postives = 129/154 (83.77%), Query Frame = 1
Query:    1 NLLNEAAILAGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVTTGAAGDLQQITGLAKQMVTTFGMSEIGPWSL 462
            NLLNEAAIL  RR K+A++  EID SIDR+VAG+EGT + D KSK L+AYHEVGHAI G+L   HDPVQKVTL+PRGQARGLTWF PSDD +LIS+ Q+ ARIVG LGGRAAEE+IFG  EVTTGA+ DLQQ+T +A+QMVT FGMS+IGP SL
Sbjct:  384 NLLNEAAILTARRRKSAMTMSEIDTSIDRVVAGLEGTPLIDSKSKRLIAYHEVGHAIIGSLLEHHDPVQKVTLIPRGQARGLTWFTPSDDQSLISRSQILARIVGALGGRAAEEIIFGDAEVTTGASNDLQQVTSMARQMVTRFGMSKIGPLSL 537          
BLAST of CX288518 vs. ExPASy Swiss-Prot
Match: FTSH_GUITH (Cell division protease ftsH homolog OS=Guillardia theta GN=ftsH PE=3 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 8.518e-58
Identity = 113/172 (65.70%), Postives = 132/172 (76.74%), Query Frame = 1
Query:    1 NLLNEAAILAGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVTTGAAGDLQQITGLAKQMVTTFGMSEIGPWSLMDGSQSGDVIMRMMARNS 516
            NLLNEAAIL  RR K  I+  EID SIDR++AGMEG  + D K+K L+AYHEVGHAI GTL   HDPVQKVTLVPRGQA+GLTWF PS+D +LIS+ Q+ ARI+G LGGRAAEEV+FG PEVTTGA  DLQQ+T +A+QMVT FGMS IGP SL +   S   + R M  +S
Sbjct:  384 NLLNEAAILTARRRKKQITISEIDASIDRVIAGMEGKALVDSKTKRLIAYHEVGHAIIGTLLKHHDPVQKVTLVPRGQAKGLTWFTPSEDQSLISRSQILARIMGALGGRAAEEVVFGLPEVTTGAGNDLQQVTSMARQMVTRFGMSNIGPLSL-ESQNSDPFLGRTMGSSS 554          
BLAST of CX288518 vs. ExPASy Swiss-Prot
Match: FTSH1_SYNY3 (Cell division protease ftsH homolog 1 OS=Synechocystis sp. (strain PCC 6803) GN=slr0228 PE=3 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 1.607e-56
Identity = 109/165 (66.06%), Postives = 130/165 (78.79%), Query Frame = 1
Query:    1 NLLNEAAILAGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVTTGAAGDLQQITGLAKQMVTTFGMSEIGPWSLMDGSQSGDVIM 495
            NLLNEAAIL  RR K+AI+  EIDD++DR+VAGMEGT + D KSK L+AYHEVGHAI GTL   HDPVQKVTL+PRGQA+GLTWF P+++  L +K QL ARI G +GGRAAEE +FG  EVTTGA GDLQQ+T +A+QMVT FGMS +GP SL   S  G+V +
Sbjct:  383 NLLNEAAILTARRRKSAITLLEIDDAVDRVVAGMEGTPLVDSKSKRLIAYHEVGHAIVGTLLKDHDPVQKVTLIPRGQAQGLTWFTPNEEQGLTTKAQLMARIAGAMGGRAAEEEVFGDDEVTTGAGGDLQQVTEMARQMVTRFGMSNLGPISL--ESSGGEVFL 545          
BLAST of CX288518 vs. ExPASy Swiss-Prot
Match: FTSH_CYACA (Cell division protease ftsH homolog OS=Cyanidium caldarium GN=ftsH PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 4.837e-53
Identity = 97/173 (56.07%), Postives = 130/173 (75.14%), Query Frame = 1
Query:    1 NLLNEAAILAGRRGKAAISSKEIDDSIDRIVAGMEGTVMTDGKSKSLVAYHEVGHAICGTLTPGHDPVQKVTLVPRGQARGLTWFIPSDDPTLISKQQLFARIVGGLGGRAAEEVIFGGPEVTTGAAGDLQQITGLAKQMVTTFGMSEIGPWSLMDGSQSGDVIMRMMARNSM 519
            NLLNEAAIL  RRGK  I+ KEI+DSID+I+AG+EG+ + D + K L+AYHE GHA+  T  P HDPVQKVTL+PR QA+GLTWF+P+DD  L+SK Q+ ++I+  L GRA EE++FG PEVT GAA D++Q+T +A+QMVT FGMS++GP  L + S    +   +M R+ +
Sbjct:  382 NLLNEAAILTVRRGKVEITMKEIEDSIDKIIAGLEGSPLADSRIKRLIAYHEAGHAVAATFLPHHDPVQKVTLIPRRQAKGLTWFLPNDDQFLVSKSQILSKIIAALAGRAMEEIVFGLPEVTIGAANDIKQVTFMARQMVTKFGMSKVGPICLENSSSEVFIGRDLMGRHEL 554          
The following BLAST results are available for this feature:
BLAST of CX288518 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 83
Match NameE-valueIdentityDescription
FTSH2_ORYSJ1.219e-8893.68Cell division protease ftsH homolog 2, chloroplast... [more]
FTSH8_ARATH1.760e-8793.64Cell division protease ftsH homolog 8, chloroplast... [more]
FTSH2_ARATH1.261e-8590.17Cell division protease ftsH homolog 2, chloroplast... [more]
FTSH6_ARATH3.114e-7679.89Cell division protease ftsH homolog 6, chloroplast... [more]
FTSH6_ORYSJ2.728e-7275.43Cell division protease ftsH homolog 6, chloroplast... [more]
FSTH_PORYE1.552e-5971.60Cell division protease ftsH homolog OS=Porphyra ye... [more]
FTSH_PORPU7.705e-5972.08Cell division protease ftsH homolog OS=Porphyra pu... [more]
FTSH_GUITH8.518e-5865.70Cell division protease ftsH homolog OS=Guillardia ... [more]
FTSH1_SYNY31.607e-5666.06Cell division protease ftsH homolog 1 OS=Synechocy... [more]
FTSH_CYACA4.837e-5356.07Cell division protease ftsH homolog OS=Cyanidium c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02001C11SK IF1 Citrus clementina cDNA clone C02001C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288518 ID=CX288518|Name=CX288518|organism=Citrus clementina|type=EST|length=521bp
AACCTCTTAAATGAGGCTGCTATATTGGCTGGACGACGTGGGAAAGCTGC
TATTTCATCTAAAGAGATTGATGATTCGATTGATAGGATTGTGGCTGGAA
TGGAAGGAACTGTCATGACAGATGGGAAGAGTAAAAGTCTTGTTGCATAC
CATGAAGTTGGCCACGCAATATGCGGAACTTTGACTCCTGGACACGATCC
CGTTCAAAAAGTCACCCTTGTTCCACGTGGTCAGGCAAGAGGTCTTACCT
GGTTCATCCCTTCAGATGACCCCACCTTGATATCGAAGCAGCAGCTCTTT
GCAAGAATTGTTGGTGGACTCGGTGGTAGAGCTGCTGAGGAAGTGATTTT
TGGAGGGCCTGAAGTGACAACAGGAGCAGCTGGTGATTTGCAGCAGATCA
CTGGTTTGGCCAAACAGATGGTAACCACATTTGGAATGTCTGAAATTGGC
CCATGGTCGCTCATGGACGGATCACAGAGTGGTGATGTCATCATGAGAAT
GATGGCAAGGAACTCAATGTC
back to top