CX288942

Overview
NameCX288942
Unique NameCX288942
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length413
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig6678 contig Ccv1_Contig6678:978..1390. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX288942 vs. ExPASy Swiss-Prot
Match: U2A2B_NICPL (Splicing factor U2af large subunit B OS=Nicotiana plumbaginifolia GN=U2AF65B PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 4.937e-71
Identity = 132/137 (96.35%), Postives = 134/137 (97.81%), Query Frame = 2
Query:    2 KFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIG*AALNGI 412
            KFAFVEMRSVEEASNAMALDGIIFEGAP KVRRPSDYNPSLAATLGPSQPNPNLNLAAVGL+PGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQD+SVTDI  AALNGI
Sbjct:  287 KFAFVEMRSVEEASNAMALDGIIFEGAPCKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLSPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDVSVTDIACAALNGI 423          
BLAST of CX288942 vs. ExPASy Swiss-Prot
Match: U2A2A_ORYSJ (Splicing factor U2af large subunit A OS=Oryza sativa subsp. japonica GN=U2AF65A PE=2 SV=2)

HSP 1 Score: 264.618 bits (675), Expect = 1.100e-70
Identity = 130/137 (94.89%), Postives = 134/137 (97.81%), Query Frame = 2
Query:    2 KFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIG*AALNGI 412
            KFAFVEMRSVEEASNAMALDGI+FEGAPVKVRRP+DYNPSLAA LGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQ+RELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDL+VTDI  AALNGI
Sbjct:  286 KFAFVEMRSVEEASNAMALDGIMFEGAPVKVRRPTDYNPSLAAALGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQVRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLNVTDIACAALNGI 422          
BLAST of CX288942 vs. ExPASy Swiss-Prot
Match: U2A2B_ORYSJ (Splicing factor U2af large subunit B OS=Oryza sativa subsp. japonica GN=U2AF65B PE=2 SV=2)

HSP 1 Score: 263.077 bits (671), Expect = 3.200e-70
Identity = 129/137 (94.16%), Postives = 134/137 (97.81%), Query Frame = 2
Query:    2 KFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIG*AALNGI 412
            KFAFVEMRSVEEASNAMALDGI+FEGAPVKVRRP+DYNPSLAA LGPSQP+PNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQ+RELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDL+VTDI  AALNGI
Sbjct:  262 KFAFVEMRSVEEASNAMALDGILFEGAPVKVRRPTDYNPSLAAALGPSQPSPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQVRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLNVTDIACAALNGI 398          
BLAST of CX288942 vs. ExPASy Swiss-Prot
Match: U2A2B_WHEAT (Splicing factor U2af large subunit B OS=Triticum aestivum GN=U2AF65B PE=2 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 2.709e-69
Identity = 128/137 (93.43%), Postives = 133/137 (97.08%), Query Frame = 2
Query:    2 KFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIG*AALNGI 412
            KFAFVEMRSVEEASNAMALDGI+FEGAPVKVRRP+DYNPSLAA LGPSQP+ NLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQ+RELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDL+VTDI  AALNGI
Sbjct:  255 KFAFVEMRSVEEASNAMALDGILFEGAPVKVRRPTDYNPSLAAALGPSQPSSNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQVRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLNVTDIACAALNGI 391          
BLAST of CX288942 vs. ExPASy Swiss-Prot
Match: U2A2A_NICPL (Splicing factor U2af large subunit A OS=Nicotiana plumbaginifolia GN=U2AF65A PE=2 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 1.344e-68
Identity = 127/137 (92.70%), Postives = 132/137 (96.35%), Query Frame = 2
Query:    2 KFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIG*AALNGI 412
            KFAFVEMRSVEEASNAMALDG+IFEG PVKVRRPSDYNPSLAATLGPSQP+PNLNLAAVG TPGS+GGLEGPDRIFVGGLPYYFTE+QIRELLESFG LRGFDLVKDRETGNSKGYAFCVYQD+SVTDI  AALNGI
Sbjct:  269 KFAFVEMRSVEEASNAMALDGVIFEGGPVKVRRPSDYNPSLAATLGPSQPSPNLNLAAVGSTPGSSGGLEGPDRIFVGGLPYYFTESQIRELLESFGQLRGFDLVKDRETGNSKGYAFCVYQDVSVTDIACAALNGI 405          
BLAST of CX288942 vs. ExPASy Swiss-Prot
Match: U2A2A_ARATH (Splicing factor U2af large subunit A OS=Arabidopsis thaliana GN=U2AF65A PE=2 SV=2)

HSP 1 Score: 256.914 bits (655), Expect = 2.293e-68
Identity = 126/137 (91.97%), Postives = 134/137 (97.81%), Query Frame = 2
Query:    2 KFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIG*AALNGI 412
            KFAFVEMRSVEEASNAM+LDGIIFEGAPVKVRRPSDYNPSLAATLGPSQP+P+LNLAAVGLTPG++GGLEGPDRIFVGGLPYYFTE+Q+RELLESFG L+GFDLVKDRETGNSKGYAFCVYQDLSVTDI  AALNGI
Sbjct:  287 KFAFVEMRSVEEASNAMSLDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPSPHLNLAAVGLTPGASGGLEGPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAALNGI 423          
BLAST of CX288942 vs. ExPASy Swiss-Prot
Match: U2A2B_ARATH (Splicing factor U2af large subunit B OS=Arabidopsis thaliana GN=U2AF65B PE=2 SV=2)

HSP 1 Score: 251.521 bits (641), Expect = 9.635e-67
Identity = 125/137 (91.24%), Postives = 128/137 (93.43%), Query Frame = 2
Query:    2 KFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIG*AALNGI 412
            KFAFVEMRSVEEASNAMALDGII EG PVKVRRP+DYNPSLAATLGPSQPNPNLNL AVGL+ GS GGLEGPDRIFVGGLPYYFTE QIRELLESFGPLRGF+LVKDRETGNSKGYAFCVYQD SVTDI  AALNGI
Sbjct:  303 KFAFVEMRSVEEASNAMALDGIILEGVPVKVRRPTDYNPSLAATLGPSQPNPNLNLGAVGLSSGSTGGLEGPDRIFVGGLPYYFTEVQIRELLESFGPLRGFNLVKDRETGNSKGYAFCVYQDPSVTDIACAALNGI 439          
BLAST of CX288942 vs. ExPASy Swiss-Prot
Match: U2A2A_WHEAT (Splicing factor U2af large subunit A OS=Triticum aestivum GN=U2AF65A PE=2 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 1.643e-66
Identity = 121/137 (88.32%), Postives = 131/137 (95.62%), Query Frame = 2
Query:    2 KFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIG*AALNGI 412
            KFAFVEMRSVEEASNAMALDGI+FEGAPVKVRRP+DYNPS AA LGPSQPNPNLNLAAVGLTPG+ GGLEGPDRIFVGGLPYYFTEAQ+RELLE+FGPLRGFD+VKD+ETGNSKGYAFC+Y+D +VTDI  AALNGI
Sbjct:  320 KFAFVEMRSVEEASNAMALDGIMFEGAPVKVRRPTDYNPSQAAALGPSQPNPNLNLAAVGLTPGAGGGLEGPDRIFVGGLPYYFTEAQVRELLETFGPLRGFDIVKDKETGNSKGYAFCLYKDGTVTDIACAALNGI 456          
BLAST of CX288942 vs. ExPASy Swiss-Prot
Match: U2AF2_MOUSE (Splicing factor U2AF 65 kDa subunit OS=Mus musculus GN=U2af2 PE=1 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 7.212e-30
Identity = 69/136 (50.74%), Postives = 88/136 (64.71%), Query Frame = 2
Query:    5 FAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIG*AALNGI 412
            FAF+E RSV+E + AMA DGIIF+G  +K+RRP DY P    +  PS   P +    V   P SA       ++F+GGLP Y  + Q++ELL SFGPL+ F+LVKD  TG SKGYAFC Y D++VTD   A LNG+
Sbjct:  197 FAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVV---PDSA------HKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGM 323          
BLAST of CX288942 vs. ExPASy Swiss-Prot
Match: U2AF2_HUMAN (Splicing factor U2AF 65 kDa subunit OS=Homo sapiens GN=U2AF2 PE=1 SV=4)

HSP 1 Score: 129.028 bits (323), Expect = 7.212e-30
Identity = 69/136 (50.74%), Postives = 88/136 (64.71%), Query Frame = 2
Query:    5 FAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPNPNLNLAAVGLTPGSAGGLEGPDRIFVGGLPYYFTEAQIRELLESFGPLRGFDLVKDRETGNSKGYAFCVYQDLSVTDIG*AALNGI 412
            FAF+E RSV+E + AMA DGIIF+G  +K+RRP DY P    +  PS   P +    V   P SA       ++F+GGLP Y  + Q++ELL SFGPL+ F+LVKD  TG SKGYAFC Y D++VTD   A LNG+
Sbjct:  197 FAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVV---PDSA------HKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGM 323          
The following BLAST results are available for this feature:
BLAST of CX288942 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
U2A2B_NICPL4.937e-7196.35Splicing factor U2af large subunit B OS=Nicotiana ... [more]
U2A2A_ORYSJ1.100e-7094.89Splicing factor U2af large subunit A OS=Oryza sati... [more]
U2A2B_ORYSJ3.200e-7094.16Splicing factor U2af large subunit B OS=Oryza sati... [more]
U2A2B_WHEAT2.709e-6993.43Splicing factor U2af large subunit B OS=Triticum a... [more]
U2A2A_NICPL1.344e-6892.70Splicing factor U2af large subunit A OS=Nicotiana ... [more]
U2A2A_ARATH2.293e-6891.97Splicing factor U2af large subunit A OS=Arabidopsi... [more]
U2A2B_ARATH9.635e-6791.24Splicing factor U2af large subunit B OS=Arabidopsi... [more]
U2A2A_WHEAT1.643e-6688.32Splicing factor U2af large subunit A OS=Triticum a... [more]
U2AF2_MOUSE7.212e-3050.74Splicing factor U2AF 65 kDa subunit OS=Mus musculu... [more]
U2AF2_HUMAN7.212e-3050.74Splicing factor U2AF 65 kDa subunit OS=Homo sapien... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02007B11SK IF1 Citrus clementina cDNA clone C02007B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288942 ID=CX288942|Name=CX288942|organism=Citrus clementina|type=EST|length=413bp
GAAGTTTGCCTTTGTGGAGATGAGATCTGTGGAGGAAGCCAGTAATGCTA
TGGCTTTAGATGGAATTATTTTTGAGGGAGCCCCTGTGAAGGTGAGGAGA
CCCAGTGACTATAACCCATCTCTTGCTGCAACACTTGGTCCCAGCCAGCC
CAATCCCAATCTTAACCTGGCTGCTGTTGGTCTAACACCTGGTTCCGCTG
GTGGGCTTGAGGGTCCAGACCGCATTTTTGTCGGTGGGCTCCCCTATTAC
TTCACAGAAGCACAGATCAGGGAATTGTTGGAGTCTTTTGGGCCCCTGCG
TGGTTTTGATCTAGTTAAAGATAGAGAAACTGGAAACTCAAAGGGCTATG
CGTTTTGTGTTTACCAAGATCTTTCAGTTACAGATATAGGATGAGCTGCC
TTGAATGGGATTA
back to top