CX288947

Overview
NameCX288947
Unique NameCX288947
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length311
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig7570 contig Ccv1_Contig7570:474..784. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX288947 vs. ExPASy Swiss-Prot
Match: CADH1_OCIBA (Cinnamyl alcohol dehydrogenase 1 OS=Ocimum basilicum GN=CAD1 PE=1 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 2.807e-34
Identity = 75/103 (72.82%), Postives = 79/103 (76.70%), Query Frame = 3
Query:    3 KFVVKIPDGMALEQAAPLLCAGVTVFSPLSHFGLKQSXXXXXXXXXXXXXXXXXXXAKAMGHHVTVISSSDKKRVEAMEHLGADQYLVSSDATGMQEAADSLD 311
            KFVVKIPDGMA EQAAPLLCAGVTV+SPL+HFGLKQS                   AKAMGHHVTVISSSDKKR EA++HLGAD YLVSSDA  MQEAADSLD
Sbjct:  144 KFVVKIPDGMAPEQAAPLLCAGVTVYSPLNHFGLKQSGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSDKKRAEALDHLGADDYLVSSDAARMQEAADSLD 246          
BLAST of CX288947 vs. ExPASy Swiss-Prot
Match: CADH_POPDE (Probable cinnamyl alcohol dehydrogenase OS=Populus deltoides PE=2 SV=2)

HSP 1 Score: 137.887 bits (346), Expect = 1.540e-32
Identity = 71/103 (68.93%), Postives = 77/103 (74.76%), Query Frame = 3
Query:    3 KFVVKIPDGMALEQAAPLLCAGVTVFSPLSHFGLKQSXXXXXXXXXXXXXXXXXXXAKAMGHHVTVISSSDKKRVEAMEHLGADQYLVSSDATGMQEAADSLD 311
            KFVV+IPDGM+ EQAAPLLCAG+TV+SPL HFGLKQS                   AKAMGHHVTVISSSDKKR EAMEHLGAD+YLVSSD   MQ+AAD LD
Sbjct:  144 KFVVRIPDGMSPEQAAPLLCAGLTVYSPLKHFGLKQSGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSDKKREEAMEHLGADEYLVSSDVESMQKAADQLD 246          
BLAST of CX288947 vs. ExPASy Swiss-Prot
Match: CADH1_ARACO (Probable cinnamyl alcohol dehydrogenase 1 OS=Aralia cordata GN=CAD1 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.627e-32
Identity = 74/104 (71.15%), Postives = 80/104 (76.92%), Query Frame = 3
Query:    3 KFVVKIPDGMALEQAAPLLCAGVTVFSPLSHFGLKQ-SXXXXXXXXXXXXXXXXXXXAKAMGHHVTVISSSDKKRVEAMEHLGADQYLVSSDATGMQEAADSLD 311
            KFVVKIPDGMA EQAAPLLCAGVTV+SPL+HFGLK+ S                   AKAMGHHVTVISSSDKK+ EA++HLGAD YLVSSDAT MQEAADSLD
Sbjct:  144 KFVVKIPDGMAPEQAAPLLCAGVTVYSPLTHFGLKEISGLRGGILGLGGVGHMGVKLAKAMGHHVTVISSSDKKKEEAIDHLGADAYLVSSDATQMQEAADSLD 247          
BLAST of CX288947 vs. ExPASy Swiss-Prot
Match: CADH1_TOBAC (Probable cinnamyl alcohol dehydrogenase 1 OS=Nicotiana tabacum GN=CAD14 PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 7.644e-32
Identity = 70/103 (67.96%), Postives = 77/103 (74.76%), Query Frame = 3
Query:    3 KFVVKIPDGMALEQAAPLLCAGVTVFSPLSHFGLKQSXXXXXXXXXXXXXXXXXXXAKAMGHHVTVISSSDKKRVEAMEHLGADQYLVSSDATGMQEAADSLD 311
            KFVVKIP+GMA EQAAPLLCAG+TV+SPL+HFG KQS                   AKAMGHHVTVISSS+KKR EA+EHLGAD YLVSSD   MQEA+DSLD
Sbjct:  144 KFVVKIPEGMAPEQAAPLLCAGITVYSPLNHFGFKQSGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSNKKRQEALEHLGADDYLVSSDTDKMQEASDSLD 246          
BLAST of CX288947 vs. ExPASy Swiss-Prot
Match: CADH_EUCGL (Probable cinnamyl alcohol dehydrogenase OS=Eucalyptus globulus GN=CAD PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.905e-31
Identity = 69/103 (66.99%), Postives = 75/103 (72.82%), Query Frame = 3
Query:    3 KFVVKIPDGMALEQAAPLLCAGVTVFSPLSHFGLKQSXXXXXXXXXXXXXXXXXXXAKAMGHHVTVISSSDKKRVEAMEHLGADQYLVSSDATGMQEAADSLD 311
            +FVVKIPDG+  EQAAPL+CAGVTV+SPL  FGLKQS                   AKAMGHHVTVISSSDKKR EA+EHLGAD YLVSSD  GM+EA DSLD
Sbjct:  144 RFVVKIPDGLESEQAAPLMCAGVTVYSPLVRFGLKQSGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSDKKRTEALEHLGADAYLVSSDENGMKEATDSLD 246          
BLAST of CX288947 vs. ExPASy Swiss-Prot
Match: CADH2_EUCGU (Probable cinnamyl alcohol dehydrogenase 2 OS=Eucalyptus gunnii GN=CAD2 PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.905e-31
Identity = 69/103 (66.99%), Postives = 75/103 (72.82%), Query Frame = 3
Query:    3 KFVVKIPDGMALEQAAPLLCAGVTVFSPLSHFGLKQSXXXXXXXXXXXXXXXXXXXAKAMGHHVTVISSSDKKRVEAMEHLGADQYLVSSDATGMQEAADSLD 311
            +FVVKIPDG+  EQAAPL+CAGVTV+SPL  FGLKQS                   AKAMGHHVTVISSSDKKR EA+EHLGAD YLVSSD  GM+EA DSLD
Sbjct:  144 RFVVKIPDGLESEQAAPLMCAGVTVYSPLVRFGLKQSGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSDKKRTEALEHLGADAYLVSSDENGMKEATDSLD 246          
BLAST of CX288947 vs. ExPASy Swiss-Prot
Match: CADH_MEDSA (Probable cinnamyl alcohol dehydrogenase OS=Medicago sativa GN=CAD2 PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 6.471e-31
Identity = 69/103 (66.99%), Postives = 75/103 (72.82%), Query Frame = 3
Query:    3 KFVVKIPDGMALEQAAPLLCAGVTVFSPLSHFGLKQSXXXXXXXXXXXXXXXXXXXAKAMGHHVTVISSSDKKRVEAMEHLGADQYLVSSDATGMQEAADSLD 311
            KFVVKIP+G+A EQ APLLCAGVTV+SPLSHFGLK                     AKA+GHHVTVISSSDKK+ EA+E LGAD YLVSSD  GMQEAADSLD
Sbjct:  145 KFVVKIPEGLAPEQVAPLLCAGVTVYSPLSHFGLKTPGLRGGILGLGGVGHMGVKVAKALGHHVTVISSSDKKKKEALEDLGADNYLVSSDTVGMQEAADSLD 247          
BLAST of CX288947 vs. ExPASy Swiss-Prot
Match: CADH4_ARATH (Cinnamyl alcohol dehydrogenase 4 OS=Arabidopsis thaliana GN=CAD4 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 8.451e-31
Identity = 69/103 (66.99%), Postives = 75/103 (72.82%), Query Frame = 3
Query:    3 KFVVKIPDGMALEQAAPLLCAGVTVFSPLSHFGLKQSXXXXXXXXXXXXXXXXXXXAKAMGHHVTVISSSDKKRVEAMEHLGADQYLVSSDATGMQEAADSLD 311
            KFVVKIP+GMA+EQAAPLLCAGVTV+SPLSHFGL  S                   AKAMGHHVTVISSSDKK+ EA+EHLGAD Y+VSSD   MQ  ADSLD
Sbjct:  145 KFVVKIPEGMAVEQAAPLLCAGVTVYSPLSHFGLMASGLKGGILGLGGVGHMGVKIAKAMGHHVTVISSSDKKKEEAIEHLGADDYVVSSDPAEMQRLADSLD 247          
BLAST of CX288947 vs. ExPASy Swiss-Prot
Match: CADH1_EUCGU (Probable cinnamyl alcohol dehydrogenase 1 OS=Eucalyptus gunnii GN=CAD1 PE=3 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.104e-30
Identity = 68/103 (66.02%), Postives = 74/103 (71.84%), Query Frame = 3
Query:    3 KFVVKIPDGMALEQAAPLLCAGVTVFSPLSHFGLKQSXXXXXXXXXXXXXXXXXXXAKAMGHHVTVISSSDKKRVEAMEHLGADQYLVSSDATGMQEAADSLD 311
            +FVVKIPDG+  EQAAPL+CAGVTV+ PL  FGLKQS                   AKAMGHHVTVISSSDKKR EA+EHLGAD YLVSSD  GM+EA DSLD
Sbjct:  144 RFVVKIPDGLESEQAAPLMCAGVTVYRPLVRFGLKQSGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSDKKRTEALEHLGADAYLVSSDENGMKEATDSLD 246          
BLAST of CX288947 vs. ExPASy Swiss-Prot
Match: CADH2_TOBAC (Probable cinnamyl alcohol dehydrogenase 2 OS=Nicotiana tabacum GN=CAD19 PE=1 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 1.442e-30
Identity = 68/102 (66.67%), Postives = 74/102 (72.55%), Query Frame = 3
Query:    6 FVVKIPDGMALEQAAPLLCAGVTVFSPLSHFGLKQSXXXXXXXXXXXXXXXXXXXAKAMGHHVTVISSSDKKRVEAMEHLGADQYLVSSDATGMQEAADSLD 311
            FVVKIP+GMA EQAAPLLCAG+TV+SP +HFG  QS                   AKAMGHHVTVISSS+KKR EA+EHLGAD YLVSSD   MQEAADSLD
Sbjct:  145 FVVKIPEGMAPEQAAPLLCAGITVYSPFNHFGFNQSGFRGGILGLGGVGHMGVKIAKAMGHHVTVISSSNKKRQEALEHLGADDYLVSSDTDKMQEAADSLD 246          
The following BLAST results are available for this feature:
BLAST of CX288947 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 45
Match NameE-valueIdentityDescription
CADH1_OCIBA2.807e-3472.82Cinnamyl alcohol dehydrogenase 1 OS=Ocimum basilic... [more]
CADH_POPDE1.540e-3268.93Probable cinnamyl alcohol dehydrogenase OS=Populus... [more]
CADH1_ARACO2.627e-3271.15Probable cinnamyl alcohol dehydrogenase 1 OS=Arali... [more]
CADH1_TOBAC7.644e-3267.96Probable cinnamyl alcohol dehydrogenase 1 OS=Nicot... [more]
CADH_EUCGL2.905e-3166.99Probable cinnamyl alcohol dehydrogenase OS=Eucalyp... [more]
CADH2_EUCGU2.905e-3166.99Probable cinnamyl alcohol dehydrogenase 2 OS=Eucal... [more]
CADH_MEDSA6.471e-3166.99Probable cinnamyl alcohol dehydrogenase OS=Medicag... [more]
CADH4_ARATH8.451e-3166.99Cinnamyl alcohol dehydrogenase 4 OS=Arabidopsis th... [more]
CADH1_EUCGU1.104e-3066.02Probable cinnamyl alcohol dehydrogenase 1 OS=Eucal... [more]
CADH2_TOBAC1.442e-3066.67Probable cinnamyl alcohol dehydrogenase 2 OS=Nicot... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02007C04SK IF1 Citrus clementina cDNA clone C02007C04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288947 ID=CX288947|Name=CX288947|organism=Citrus clementina|type=EST|length=311bp
AAAAGTTTGTGGTGAAAATACCAGATGGAATGGCACTGGAGCAGGCGGCA
CCGCTATTGTGTGCTGGTGTGACAGTGTTCAGTCCCCTGAGCCACTTTGG
ATTGAAGCAGAGCGGGCTGAGAGGAGGAATCTTGGGGCTCGGAGGAGTAG
GCCACATGGGGGTTTTGATAGCTAAGGCGATGGGACACCATGTTACTGTG
ATTAGCTCTTCTGATAAGAAAAGAGTGGAAGCTATGGAGCATCTTGGTGC
CGATCAGTACCTTGTCAGCTCCGACGCAACTGGTATGCAAGAAGCCGCTG
ACTCACTTGAT
back to top