CX288959

Overview
NameCX288959
Unique NameCX288959
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length503
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig164 contig Ccv1_Contig164:1..503. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX288959 vs. ExPASy Swiss-Prot
Match: PDC1_TOBAC (Pyruvate decarboxylase isozyme 1 (Fragment) OS=Nicotiana tabacum GN=PDC1 PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 2.785e-79
Identity = 143/167 (85.63%), Postives = 149/167 (89.22%), Query Frame = 3
Query:    3 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVSTALKESKPVYISVACNLPAIPHPTFSREPVPFSLSPKLSNEMGLXXXXXXXXXFLNKAVKPVLVAGPKMRVAKACNAFVELADACGYAVAVMPSAKGLVPEHHPHFIGTY 503
            IVGGPNSNDYGTNRILHHTIGL DFSQE RCFQTVTCY+AVVNNLEDAHELIDTAVSTALKESKPVYIS+ CNLP IPHPTFSREPVPF+LSP+LSN MGL         FLNKAVKPVLV GPKMRVAKA +AFVEL+DACGYAVAVMPSAKGL PEHH HFIGTY
Sbjct:   42 IVGGPNSNDYGTNRILHHTIGLQDFSQEPRCFQTVTCYRAVVNNLEDAHELIDTAVSTALKESKPVYISIGCNLPGIPHPTFSREPVPFALSPRLSNMMGLEAAVEAAAEFLNKAVKPVLVGGPKMRVAKASDAFVELSDACGYAVAVMPSAKGLFPEHHSHFIGTY 208          
BLAST of CX288959 vs. ExPASy Swiss-Prot
Match: PDC2_TOBAC (Pyruvate decarboxylase isozyme 2 OS=Nicotiana tabacum GN=PDC2 PE=2 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 3.187e-75
Identity = 132/167 (79.04%), Postives = 148/167 (88.62%), Query Frame = 3
Query:    3 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVSTALKESKPVYISVACNLPAIPHPTFSREPVPFSLSPKLSNEMGLXXXXXXXXXFLNKAVKPVLVAGPKMRVAKACNAFVELADACGYAVAVMPSAKGLVPEHHPHFIGTY 503
            IVGGPN+NDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNL+DAHE ID A+STALKESKPVYIS++CNLPAIPHPTFSR+P+PFSLSP+LSN+ GL         FL+KAVKPV++ GPK+RVAKAC+AFVELAD+ GYA+AVM   KGLV E HPHFIGTY
Sbjct:  120 IVGGPNTNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLDDAHEQIDRAISTALKESKPVYISISCNLPAIPHPTFSRDPIPFSLSPRLSNKRGLEAAVDAAVTFLSKAVKPVMIGGPKLRVAKACDAFVELADSSGYAMAVMLQPKGLVAEQHPHFIGTY 286          
BLAST of CX288959 vs. ExPASy Swiss-Prot
Match: PDC1_PEA (Pyruvate decarboxylase isozyme 1 OS=Pisum sativum GN=PDC1 PE=2 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 5.435e-75
Identity = 130/167 (77.84%), Postives = 148/167 (88.62%), Query Frame = 3
Query:    3 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVSTALKESKPVYISVACNLPAIPHPTFSREPVPFSLSPKLSNEMGLXXXXXXXXXFLNKAVKPVLVAGPKMRVAKACNAFVELADACGYAVAVMPSAKGLVPEHHPHFIGTY 503
            IVGGPNSNDYGTNRILHHTIGLPDFSQEL+CFQT+TC+QAVVNNL+DAHELIDTA+STALKESKPVYIS+ CNLPAIPHPTF+R+PVPF L+P++SN+ GL         FLNKAVKPV+V GPK+RVAKA  AF+E A+A GY +AVMPS KGLVPE+HPHFIGTY
Sbjct:  125 IVGGPNSNDYGTNRILHHTIGLPDFSQELQCFQTITCFQAVVNNLDDAHELIDTAISTALKESKPVYISIGCNLPAIPHPTFARDPVPFFLAPRVSNQAGLEAAVEEAAAFLNKAVKPVIVGGPKLRVAKAQKAFMEFAEASGYPIAVMPSGKGLVPENHPHFIGTY 291          
BLAST of CX288959 vs. ExPASy Swiss-Prot
Match: PDC2_ORYSJ (Pyruvate decarboxylase isozyme 2 OS=Oryza sativa subsp. japonica GN=PDC2 PE=2 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 1.211e-74
Identity = 132/167 (79.04%), Postives = 146/167 (87.43%), Query Frame = 3
Query:    3 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVSTALKESKPVYISVACNLPAIPHPTFSREPVPFSLSPKLSNEMGLXXXXXXXXXFLNKAVKPVLVAGPKMRVAKACNAFVELADACGYAVAVMPSAKGLVPEHHPHFIGTY 503
            I GGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTC+QAVV NLEDAHE IDTA++TAL+ESKPVY+S++CNLP +PHPTFSR+PVPF L+P+LSN+MGL         FLNKAVKPVLV GPK+RVAKA  AFV+L DA GYA AVMPSAKGLVPE HPHFIGTY
Sbjct:  138 IAGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCHQAVVTNLEDAHEQIDTAIATALRESKPVYLSISCNLPGLPHPTFSRDPVPFFLAPRLSNKMGLEAAVEATVEFLNKAVKPVLVGGPKLRVAKAGKAFVDLVDASGYAYAVMPSAKGLVPETHPHFIGTY 304          
BLAST of CX288959 vs. ExPASy Swiss-Prot
Match: PDC2_ORYSI (Pyruvate decarboxylase isozyme 2 OS=Oryza sativa subsp. indica GN=PDC2 PE=2 SV=2)

HSP 1 Score: 278.485 bits (711), Expect = 1.211e-74
Identity = 132/167 (79.04%), Postives = 146/167 (87.43%), Query Frame = 3
Query:    3 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVSTALKESKPVYISVACNLPAIPHPTFSREPVPFSLSPKLSNEMGLXXXXXXXXXFLNKAVKPVLVAGPKMRVAKACNAFVELADACGYAVAVMPSAKGLVPEHHPHFIGTY 503
            I GGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTC+QAVV NLEDAHE IDTA++TAL+ESKPVY+S++CNLP +PHPTFSR+PVPF L+P+LSN+MGL         FLNKAVKPVLV GPK+RVAKA  AFV+L DA GYA AVMPSAKGLVPE HPHFIGTY
Sbjct:  138 IAGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCHQAVVTNLEDAHEQIDTAIATALRESKPVYLSISCNLPGLPHPTFSRDPVPFFLAPRLSNKMGLEAAVEATVEFLNKAVKPVLVGGPKLRVAKAGKAFVDLVDASGYAYAVMPSAKGLVPETHPHFIGTY 304          
BLAST of CX288959 vs. ExPASy Swiss-Prot
Match: PDC3_ORYSI (Pyruvate decarboxylase isozyme 3 OS=Oryza sativa subsp. indica GN=PDC3 PE=2 SV=2)

HSP 1 Score: 269.626 bits (688), Expect = 5.625e-72
Identity = 130/167 (77.84%), Postives = 145/167 (86.83%), Query Frame = 3
Query:    3 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVSTALKESKPVYISVACNLPAIPHPTFSREPVPFSLSPKLSNEMGLXXXXXXXXXFLNKAVKPVLVAGPKMRVAKACNAFVELADACGYAVAVMPSAKGLVPEHHPHFIGTY 503
            IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQ +TCYQAVVNNL+DAH+ ID A+STA++ESKPVYISV+CNLPA+PHPTFSR+PVP+ LSP+LSN+  L         FL+KAVKPVLVAGPK+RVAKA  AFV+LADA GYAVA MPSAKGLVPE  P FIGTY
Sbjct:  118 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQPLTCYQAVVNNLDDAHDQIDRAISTAIRESKPVYISVSCNLPAVPHPTFSRDPVPYFLSPRLSNQASLHAALDATLAFLDKAVKPVLVAGPKLRVAKAGGAFVDLADASGYAVAAMPSAKGLVPETLPRFIGTY 284          
BLAST of CX288959 vs. ExPASy Swiss-Prot
Match: PDC3_ORYSJ (Pyruvate decarboxylase isozyme 3 OS=Oryza sativa subsp. japonica GN=PDC3 PE=2 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 2.137e-71
Identity = 129/167 (77.25%), Postives = 145/167 (86.83%), Query Frame = 3
Query:    3 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVSTALKESKPVYISVACNLPAIPHPTFSREPVPFSLSPKLSNEMGLXXXXXXXXXFLNKAVKPVLVAGPKMRVAKACNAFVELADACGYAVAVMPSAKGLVPEHHPHFIGTY 503
            IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQ +TCYQAVVNNL+DAH+ ID A+STA++ESKPVYISV+CNLPA+PHPTFSR+PVP+ LSP+LSN+  L         FL+KAVKPVLVAGPK+RVAKA  AFV+LADA G+AVA MPSAKGLVPE  P FIGTY
Sbjct:  118 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQPLTCYQAVVNNLDDAHDQIDRAISTAIRESKPVYISVSCNLPAVPHPTFSRDPVPYFLSPRLSNQASLHAALDATLAFLDKAVKPVLVAGPKLRVAKAGGAFVDLADASGHAVAAMPSAKGLVPETLPRFIGTY 284          
BLAST of CX288959 vs. ExPASy Swiss-Prot
Match: PDC1_ORYSI (Pyruvate decarboxylase isozyme 1 OS=Oryza sativa subsp. indica GN=PDC1 PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 8.122e-71
Identity = 125/167 (74.85%), Postives = 141/167 (84.43%), Query Frame = 3
Query:    3 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVSTALKESKPVYISVACNLPAIPHPTFSREPVPFSLSPKLSNEMGLXXXXXXXXXFLNKAVKPVLVAGPKMRVAKACNAFVELADACGYAVAVMPSAKGLVPEHHPHFIGTY 503
            IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQT+TCYQAV+NNL+DAHE IDTA++TAL+ESKPVYISV CNL  + HPTFSREPVP  +SP+LSN+  L         FLNKAVKPV+V GPK+RVAKA  AF  +A++ GY +AVMPSAKGLVPEHHP FIGTY
Sbjct:  137 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTITCYQAVINNLDDAHEQIDTAIATALRESKPVYISVGCNLAGLSHPTFSREPVPLFISPRLSNKANLEYAVEAAADFLNKAVKPVMVGGPKIRVAKAKKAFAGIAESSGYPIAVMPSAKGLVPEHHPRFIGTY 303          
BLAST of CX288959 vs. ExPASy Swiss-Prot
Match: PDC1_MAIZE (Pyruvate decarboxylase isozyme 1 OS=Zea mays GN=PDC1 PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 1.809e-70
Identity = 124/167 (74.25%), Postives = 141/167 (84.43%), Query Frame = 3
Query:    3 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVSTALKESKPVYISVACNLPAIPHPTFSREPVPFSLSPKLSNEMGLXXXXXXXXXFLNKAVKPVLVAGPKMRVAKACNAFVELADACGYAVAVMPSAKGLVPEHHPHFIGTY 503
            IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQT+TCYQA++NNL+DAHE IDTA++TAL+ESKPVYISV+CNL  + HPTFSR+PVP  +SP+LSN+  L         FLNKAVKPV+V GPK+RVAKA  AF  +ADA GY  AVMP+AKGLVPEHHP FIGTY
Sbjct:  142 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTITCYQAIINNLDDAHEQIDTAIATALRESKPVYISVSCNLAGLSHPTFSRDPVPMFISPRLSNKANLEYAVEAAADFLNKAVKPVMVGGPKIRVAKAREAFAAVADASGYPFAVMPAAKGLVPEHHPRFIGTY 308          
BLAST of CX288959 vs. ExPASy Swiss-Prot
Match: PDC1_ORYSJ (Pyruvate decarboxylase isozyme 1 OS=Oryza sativa subsp. japonica GN=PDC1 PE=2 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 2.363e-70
Identity = 125/167 (74.85%), Postives = 140/167 (83.83%), Query Frame = 3
Query:    3 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVSTALKESKPVYISVACNLPAIPHPTFSREPVPFSLSPKLSNEMGLXXXXXXXXXFLNKAVKPVLVAGPKMRVAKACNAFVELADACGYAVAVMPSAKGLVPEHHPHFIGTY 503
            IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQT+TCYQAV+NNL+DAHE IDTA++TAL+ESKPVYISV CNL  + HPTFSREPVP  +SP+LSN+  L         FLNKAVKPV+V GPK+RVAKA  AF  +A++ GY  AVMPSAKGLVPEHHP FIGTY
Sbjct:  137 IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTITCYQAVINNLDDAHEQIDTAIATALRESKPVYISVGCNLAGLSHPTFSREPVPLFISPRLSNKANLEYAVEAAADFLNKAVKPVMVGGPKIRVAKAKKAFAGIAESSGYPFAVMPSAKGLVPEHHPRFIGTY 303          
The following BLAST results are available for this feature:
BLAST of CX288959 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
PDC1_TOBAC2.785e-7985.63Pyruvate decarboxylase isozyme 1 (Fragment) OS=Nic... [more]
PDC2_TOBAC3.187e-7579.04Pyruvate decarboxylase isozyme 2 OS=Nicotiana taba... [more]
PDC1_PEA5.435e-7577.84Pyruvate decarboxylase isozyme 1 OS=Pisum sativum ... [more]
PDC2_ORYSJ1.211e-7479.04Pyruvate decarboxylase isozyme 2 OS=Oryza sativa s... [more]
PDC2_ORYSI1.211e-7479.04Pyruvate decarboxylase isozyme 2 OS=Oryza sativa s... [more]
PDC3_ORYSI5.625e-7277.84Pyruvate decarboxylase isozyme 3 OS=Oryza sativa s... [more]
PDC3_ORYSJ2.137e-7177.25Pyruvate decarboxylase isozyme 3 OS=Oryza sativa s... [more]
PDC1_ORYSI8.122e-7174.85Pyruvate decarboxylase isozyme 1 OS=Oryza sativa s... [more]
PDC1_MAIZE1.809e-7074.25Pyruvate decarboxylase isozyme 1 OS=Zea mays GN=PD... [more]
PDC1_ORYSJ2.363e-7074.85Pyruvate decarboxylase isozyme 1 OS=Oryza sativa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02007D06SK IF1 Citrus clementina cDNA clone C02007D06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288959 ID=CX288959|Name=CX288959|organism=Citrus clementina|type=EST|length=503bp
GCATCGTTGGTGGCCCAAACTCCAATGATTACGGAACCAACAGGATCCTT
CATCATACCATTGGCTTGCCTGATTTTAGCCAAGAACTCAGATGCTTTCA
GACTGTCACCTGTTATCAGGCTGTGGTGAATAACTTGGAGGATGCACATG
AGTTGATTGATACGGCAGTATCAACTGCTTTGAAAGAAAGCAAGCCTGTT
TATATCAGCGTTGCTTGTAACTTGCCTGCGATTCCTCATCCTACTTTTAG
CCGAGAGCCCGTTCCATTTTCGCTTTCTCCCAAGTTGAGTAATGAGATGG
GCTTGGAGGCTGCAGTTGAGGCAGCAGCAGAGTTCTTGAACAAGGCGGTG
AAACCAGTGTTGGTTGCTGGGCCCAAAATGAGAGTGGCCAAGGCTTGCAA
TGCTTTCGTTGAGCTTGCTGATGCTTGTGGCTACGCCGTTGCGGTGATGC
CATCAGCGAAAGGGCTAGTACCAGAGCACCATCCCCATTTTATTGGAACT
TAT
back to top