CX288987
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX288987 vs. ExPASy Swiss-Prot
Match: ATG4_MEDTR (Cysteine protease ATG4 OS=Medicago truncatula GN=ATG4 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.529e-11 Identity = 31/43 (72.09%), Postives = 34/43 (79.07%), Query Frame = 2 Query: 26 DREYDEILHLFGDSETSPLSIHNLF*AGKAYGLAAGSWVGPYA 154 D+EY +IL LFGDSE + SIHNL AGK YGLA GSWVGPYA Sbjct: 205 DKEYIDILQLFGDSEAAAFSIHNLLQAGKGYGLAVGSWVGPYA 247
BLAST of CX288987 vs. ExPASy Swiss-Prot
Match: ATG4A_ORYSJ (Cysteine protease ATG4A OS=Oryza sativa subsp. japonica GN=ATG4A PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.608e-11 Identity = 31/44 (70.45%), Postives = 34/44 (77.27%), Query Frame = 2 Query: 23 FDREYDEILHLFGDSETSPLSIHNLF*AGKAYGLAAGSWVGPYA 154 + EY ILH+FGDSE SIHNL AGK+YGLAAGSWVGPYA Sbjct: 191 YSPEYIGILHMFGDSEACAFSIHNLLQAGKSYGLAAGSWVGPYA 234
BLAST of CX288987 vs. ExPASy Swiss-Prot
Match: ATG4A_ORYSI (Cysteine protease ATG4A OS=Oryza sativa subsp. indica GN=ATG4A PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.608e-11 Identity = 31/44 (70.45%), Postives = 34/44 (77.27%), Query Frame = 2 Query: 23 FDREYDEILHLFGDSETSPLSIHNLF*AGKAYGLAAGSWVGPYA 154 + EY ILH+FGDSE SIHNL AGK+YGLAAGSWVGPYA Sbjct: 190 YSPEYIGILHMFGDSEACAFSIHNLLQAGKSYGLAAGSWVGPYA 233
BLAST of CX288987 vs. ExPASy Swiss-Prot
Match: ATG4B_ARATH (Cysteine protease ATG4b OS=Arabidopsis thaliana GN=ATG4B PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.407e-11 Identity = 31/43 (72.09%), Postives = 35/43 (81.40%), Query Frame = 2 Query: 26 DREYDEILHLFGDSETSPLSIHNLF*AGKAYGLAAGSWVGPYA 154 D +Y EIL LFGD+E S SIHNL AG++YGLAAGSWVGPYA Sbjct: 204 DEKYLEILELFGDTEASAFSIHNLILAGESYGLAAGSWVGPYA 246
BLAST of CX288987 vs. ExPASy Swiss-Prot
Match: ATG4B_ORYSJ (Cysteine protease ATG4B OS=Oryza sativa subsp. japonica GN=ATG4B PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.589e-11 Identity = 30/44 (68.18%), Postives = 34/44 (77.27%), Query Frame = 2 Query: 23 FDREYDEILHLFGDSETSPLSIHNLF*AGKAYGLAAGSWVGPYA 154 ++ EY ILH+FGDSE SIHNL AG +YGLAAGSWVGPYA Sbjct: 194 YNPEYIGILHMFGDSEACAFSIHNLLQAGNSYGLAAGSWVGPYA 237
BLAST of CX288987 vs. ExPASy Swiss-Prot
Match: ATG4B_ORYSI (Cysteine protease ATG4B OS=Oryza sativa subsp. indica GN=ATG4B PE=1 SV=2) HSP 1 Score: 65.855 bits (159), Expect = 7.589e-11 Identity = 30/44 (68.18%), Postives = 34/44 (77.27%), Query Frame = 2 Query: 23 FDREYDEILHLFGDSETSPLSIHNLF*AGKAYGLAAGSWVGPYA 154 ++ EY ILH+FGDSE SIHNL AG +YGLAAGSWVGPYA Sbjct: 194 YNPEYIGILHMFGDSEACAFSIHNLLQAGNSYGLAAGSWVGPYA 237 The following BLAST results are available for this feature:
BLAST of CX288987 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX288987 ID=CX288987; Name=CX288987; organism=Citrus clementina; type=EST; length=156bpback to top |