CX289053
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX289053 vs. ExPASy Swiss-Prot
Match: AS1_ARATH (Transcription factor AS1 OS=Arabidopsis thaliana GN=AS1 PE=1 SV=1) HSP 1 Score: 86.6557 bits (213), Expect = 4.519e-17 Identity = 40/73 (54.79%), Postives = 57/73 (78.08%), Query Frame = 2 Query: 2 LESEKARKRREKMDETETKIRALREEELSHLGRIESEYKEQLSALQRDAESKEAKLMEAWCSRHVKLLKLVEQ 220 LESEK ++REKM+E E K++ALREE+ + + +IE EY+EQL L+RDAE+K+ KL + W SRH++L K +EQ Sbjct: 286 LESEKTCRQREKMEEIEAKMKALREEQKNAMEKIEGEYREQLVGLRRDAEAKDQKLADQWTSRHIRLTKFLEQ 358
BLAST of CX289053 vs. ExPASy Swiss-Prot
Match: RS2_ORYSJ (Protein rough sheath 2 homolog OS=Oryza sativa subsp. japonica GN=RS2 PE=2 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 1.113e-15 Identity = 35/74 (47.30%), Postives = 58/74 (78.38%), Query Frame = 2 Query: 2 LESEKARKRREKMDETETKIRALREEELSHLGRIESEYKEQLSALQRDAESKEAKLMEAWCSRHVKLLKLVEQI 223 LE+E+A +RRE +E E K+RALREE+ + + R+E+EY+E+++ L+RDAE+KE K+ E W ++H +L K ++Q+ Sbjct: 246 LETERACRRREATEEFEAKMRALREEQAAAVERVEAEYREKMAGLRRDAEAKEQKMAEQWAAKHARLAKFLDQV 319
BLAST of CX289053 vs. ExPASy Swiss-Prot
Match: RS2_MAIZE (Protein rough sheath 2 OS=Zea mays GN=RS2 PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 7.466e-12 Identity = 30/75 (40.00%), Postives = 52/75 (69.33%), Query Frame = 2 Query: 2 LESEKARKRREKMDETETKIRALREEELSHLGRIESEYKEQLSALQRDAESKEAKLMEAWCSRHVKLLKLVEQIG 226 LE E+ +RRE +E E K+R +R E+ + R+E +++E+++ L+RDA+ KE K+ E W ++H ++ K VEQ+G Sbjct: 282 LEMEREMRRREVWEEFEAKMRTMRLEQAAAAERVERDHREKVAELRRDAQVKEEKMAEQWAAKHARVAKFVEQMG 356 The following BLAST results are available for this feature:
BLAST of CX289053 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX289053 ID=CX289053; Name=CX289053; organism=Citrus clementina; type=EST; length=435bpback to top |