CX290861

Overview
NameCX290861
Unique NameCX290861
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length506
Libraries
Library NameType
OF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig327 contig Ccv1_Contig327:1..506. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX290861 vs. ExPASy Swiss-Prot
Match: E137_ARATH (Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis thaliana GN=At4g34480 PE=1 SV=2)

HSP 1 Score: 204.912 bits (520), Expect = 1.730e-52
Identity = 99/118 (83.90%), Postives = 112/118 (94.92%), Query Frame = 1
Query:  151 IGVNYGQVADNLPPPAATAKLLQSTSIQKLRLYGADPAIIKALANTGVGIVIGASSGDIPALASDPNAATQWINSNVLPFYPASKIILITVGNEVMISNDQNLISQLLPAMTNMQNAL 504
            IGVNYGQVADNLPPP+ T KLLQSTSIQK+RLYGADPAIIKALA TGVGIVIGA++GD+P+LASDPNAATQWINSNVLPFYPASKI+LITVGNE+++SND NL++QLLPAM N+Q AL
Sbjct:   26 IGVNYGQVADNLPPPSETVKLLQSTSIQKVRLYGADPAIIKALAGTGVGIVIGAANGDVPSLASDPNAATQWINSNVLPFYPASKIMLITVGNEILMSNDPNLVNQLLPAMQNVQKAL 143          
BLAST of CX290861 vs. ExPASy Swiss-Prot
Match: E1311_ARATH (Glucan endo-1,3-beta-glucosidase 11 OS=Arabidopsis thaliana GN=At1g32860 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 8.949e-25
Identity = 54/118 (45.76%), Postives = 76/118 (64.41%), Query Frame = 1
Query:  151 IGVNYGQVADNLPPPAATAKLLQSTSIQKLRLYGADPAIIKALANTGVGIVIGASSGDIPALASDPNAATQWINSNVLPFYPASKIILITVGNEVMISNDQNLISQLLPAMTNMQNAL 504
            IGVNYGQ+ DNLP P     L++S    K++LY A+P I+KA +NTG+  +IG  +  +  +  DP+ A  WI  NV PF PA+ I  IT+GNE++  ND +L + LLPAM  + +AL
Sbjct:   29 IGVNYGQIGDNLPSPTDVIPLIKSIGATKVKLYDANPQILKAFSNTGIEFIIGLGNEYLSKM-KDPSKALTWIKQNVTPFLPATNITCITIGNEILALNDSSLTTNLLPAMQGVHSAL 145          
BLAST of CX290861 vs. ExPASy Swiss-Prot
Match: E13B_WHEAT (Glucan endo-1,3-beta-glucosidase OS=Triticum aestivum GN=GLC1 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.519e-21
Identity = 51/122 (41.80%), Postives = 75/122 (61.48%), Query Frame = 1
Query:  151 IGVNYGQVADNLPPPAATAKLLQS-TSIQKLRLYGADPAIIKALANTGVGIVIGASSGDIPALASDP---NAATQWINSNVLPFYPASKIILITVGNEVMISNDQNLISQLLPAMTNMQNAL 504
            IGVNYG  ADNLP P + A  L + T+I +++L+ A+P  I A A T + + +   +  +PALA      +AA  WI +N+ P+ PA+ + L+  GNE+++S D NLI  LLPAM  +  AL
Sbjct:   26 IGVNYGANADNLPSPTSVATFLATKTTIDRVKLFDANPTFISAFAGTPISLAVSLPNSALPALADKATGLDAARSWIRANLSPYVPATNVTLLLAGNEILLSTDTNLILSLLPAMRRLAQAL 147          
BLAST of CX290861 vs. ExPASy Swiss-Prot
Match: E1310_ARATH (Glucan endo-1,3-beta-glucosidase 10 OS=Arabidopsis thaliana GN=At5g42100 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.519e-21
Identity = 52/118 (44.07%), Postives = 71/118 (60.17%), Query Frame = 1
Query:  151 IGVNYGQVADNLPPPAATAKLLQSTSIQKLRLYGADPAIIKALANTGVGIVIGASSGDIPALASDPNAATQWINSNVLPFYPASKIILITVGNEVMISNDQNLISQLLPAMTNMQNAL 504
            IG+NYGQVA+NLPPP     LL+S    K++LY ADP  ++A A +G  + + A   +  A  SDP  A  W+  NV  + P +KI+ I VGNEV+ SN   L + L PAM ++  AL
Sbjct:   27 IGINYGQVANNLPPPKNVIPLLKSVGATKVKLYDADPQALRAFAGSGFELTV-ALGNEYLAQMSDPIKAQGWVKENVQAYLPNTKIVAIVVGNEVLTSNQSALTAALFPAMQSIHGAL 143          
BLAST of CX290861 vs. ExPASy Swiss-Prot
Match: E1314_ARATH (Glucan endo-1,3-beta-glucosidase 14 OS=Arabidopsis thaliana GN=At2g27500/F10A12.18 PE=1 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 1.337e-20
Identity = 47/118 (39.83%), Postives = 75/118 (63.56%), Query Frame = 1
Query:  151 IGVNYGQVADNLPPPAATAKLLQSTSIQKLRLYGADPAIIKALANTGVGIVIGASSGDIPALASDPNAATQWINSNVLPFYPASKIILITVGNEVMISNDQNLISQLLPAMTNMQNAL 504
            +G+NYGQ+A+NLP PA  A LL+S +I +++LY ADP ++ + +N+ V  +IG  +  +  +++DP  A  W+   + P    ++I  I VGNE+  +ND  LI  LLPAM ++  AL
Sbjct:   29 VGINYGQIANNLPSPARVAVLLRSLNITRVKLYDADPNVLFSFSNSQVDFMIGLGNEYLQNMSTDPTKAQDWLQQRLEPHISKTRITSIVVGNEIFKTNDHVLIQSLLPAMKSVYAAL 146          
BLAST of CX290861 vs. ExPASy Swiss-Prot
Match: E1312_ARATH (Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis thaliana GN=At4g29360 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 3.891e-20
Identity = 49/118 (41.53%), Postives = 78/118 (66.10%), Query Frame = 1
Query:  151 IGVNYGQVADNLPPPAATAKLLQSTSIQKLRLYGADPAIIKALANTGVGIVIGASSGDIPALASDPNAATQWINSNVLPFYPASKIILITVGNEVMISNDQNLISQLLPAMTNMQNAL 504
            IG+ YG+ ADNLP P   ++L+Q  +I+ +R+Y A+  ++KA ANTG+ ++IG  + D+ A A   +    W+++N+LP+YP++KI  I+VG EV  + D N    +LPAM N+  AL
Sbjct:   27 IGICYGRNADNLPSPNRVSELIQHLNIKFVRIYDANIDVLKAFANTGIELMIGVPNADLLAFAQFQSNVDTWLSNNILPYYPSTKITSISVGLEVTEAPD-NATGLVLPAMRNIHTAL 143          
BLAST of CX290861 vs. ExPASy Swiss-Prot
Match: GUB_NICPL (Lichenase OS=Nicotiana plumbaginifolia GN=GN1 PE=2 SV=3)

HSP 1 Score: 93.5893 bits (231), Expect = 5.618e-19
Identity = 44/119 (36.97%), Postives = 76/119 (63.87%), Query Frame = 1
Query:  151 IGVNYGQVADNLPPPAATAKLLQSTSIQKLRLYGADPAIIKALANTGVGIVIGASSGDIPALASDPNAATQWINSNVLPFYPASKIILITVGNEVM-ISNDQNLISQLLPAMTNMQNAL 504
            +GV YG + +NLPP +   +L +S +I+++RLY  + A ++AL  + + +++G  + D+  +A++P+ A  W+  NV  F+PA K   I VGNEV  ++   +L   LLPAM N++NA+
Sbjct:   33 VGVCYGMLGNNLPPASQVVQLYKSKNIRRMRLYDPNQAALQALRGSNIEVMLGVPNSDLQNIAANPSNANNWVQRNVRNFWPAVKFRYIAVGNEVSPVTGTSSLTRYLLPAMRNIRNAI 151          
BLAST of CX290861 vs. ExPASy Swiss-Prot
Match: EA6_ARATH (Probable glucan endo-1,3-beta-glucosidase A6 OS=Arabidopsis thaliana GN=A6 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.135e-18
Identity = 42/118 (35.59%), Postives = 71/118 (60.17%), Query Frame = 1
Query:  151 IGVNYGQVADNLPPPAATAKLLQSTSIQKLRLYGADPAIIKALANTGVGIVIGASSGDIPALASDPNAATQWINSNVLPFYPASKIILITVGNEVMISNDQNLISQLLPAMTNMQNAL 504
            IG+NYG+  +NLP P  +   ++S     ++LY ADP  +  L+ T + + I   +  I AL+S+   A +W+ +N+LP+YP ++I  + VGNE++  N  N+   L+PAM  + N+L
Sbjct:   42 IGINYGRRGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHQITALSSNQTIADEWVRTNILPYYPQTQIRFVLVGNEILSYNSGNVSVNLVPAMRKIVNSL 159          
BLAST of CX290861 vs. ExPASy Swiss-Prot
Match: E1313_ARATH (Glucan endo-1,3-beta-glucosidase 13 OS=Arabidopsis thaliana GN=At5g56590 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.060e-17
Identity = 43/118 (36.44%), Postives = 71/118 (60.17%), Query Frame = 1
Query:  151 IGVNYGQVADNLPPPAATAKLLQSTSIQKLRLYGADPAIIKALANTGVGIVIGASSGDIPALASDPNAATQWINSNVLPFYPASKIILITVGNEVMISNDQNLISQLLPAMTNMQNAL 504
            +GV YG+ AD+LP P+   +L+Q  +I+ +R+Y  +  ++KA  NT + ++IG  + D+ A +   +    W+ ++VLP+YP +KI  ITVG E       N  S ++PAM N+  AL
Sbjct:   26 VGVCYGRSADDLPTPSKVVQLIQQHNIKYVRIYDYNSQVLKAFGNTSIELMIGVPNSDLNAFSQSQSNVDTWLKNSVLPYYPTTKITYITVGAESTDDPHINASSFVVPAMQNVLTAL 143          
BLAST of CX290861 vs. ExPASy Swiss-Prot
Match: E13B_PHAVU (Glucan endo-1,3-beta-glucosidase, basic isoform OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.384e-17
Identity = 45/119 (37.82%), Postives = 74/119 (62.18%), Query Frame = 1
Query:  151 IGVNYGQVADNLPPPAATAKLLQSTSIQKLRLYGADPAIIKALANTGVGIVIGASSGDIPALASDPNAATQWINSNVLPFYPASKIILITVGNEVMISNDQNLISQ-LLPAMTNMQNAL 504
            IGV YG + +NLP       L +S +I+++RLY  + A ++AL N+G+ +++G  + D+  LA++ + A QW+  NVL F+P+ KI  I VGNEV      +  +Q +LPA+ N+  A+
Sbjct:    2 IGVCYGMMGNNLPSANEVINLYRSNNIRRMRLYDPNQAALQALRNSGIELILGVPNSDLQGLATNADTARQWVQRNVLNFWPSVKIKYIAVGNEVSPVGGSSWYAQYVLPAVQNVYQAV 120          
The following BLAST results are available for this feature:
BLAST of CX290861 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 43
Match NameE-valueIdentityDescription
E137_ARATH1.730e-5283.90Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis ... [more]
E1311_ARATH8.949e-2545.76Glucan endo-1,3-beta-glucosidase 11 OS=Arabidopsis... [more]
E13B_WHEAT3.519e-2141.80Glucan endo-1,3-beta-glucosidase OS=Triticum aesti... [more]
E1310_ARATH3.519e-2144.07Glucan endo-1,3-beta-glucosidase 10 OS=Arabidopsis... [more]
E1314_ARATH1.337e-2039.83Glucan endo-1,3-beta-glucosidase 14 OS=Arabidopsis... [more]
E1312_ARATH3.891e-2041.53Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis... [more]
GUB_NICPL5.618e-1936.97Lichenase OS=Nicotiana plumbaginifolia GN=GN1 PE=2... [more]
EA6_ARATH2.135e-1835.59Probable glucan endo-1,3-beta-glucosidase A6 OS=Ar... [more]
E1313_ARATH1.060e-1736.44Glucan endo-1,3-beta-glucosidase 13 OS=Arabidopsis... [more]
E13B_PHAVU1.384e-1737.82Glucan endo-1,3-beta-glucosidase, basic isoform OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC03001A04Rv OF1 Citrus clementina cDNA clone C03001A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX290861 ID=CX290861|Name=CX290861|organism=Citrus clementina|type=EST|length=506bp
CAAGGCCACAAGCAACAACACATCACAACAAATTTCACTTTCTTCTCCAT
CTATTTCTCTCTGTCCATGGCCAACTCCAACTCCTCACTCTTCCTCTTCG
TCTCTCTCCTCCTCTTTCAAGTTCTTCACTTCTCAAGTTCGCAGTCATTC
ATCGGAGTGAACTACGGCCAAGTAGCGGATAACCTGCCCCCGCCGGCGGC
TACAGCGAAGCTTCTGCAATCGACTTCTATACAGAAATTGAGGCTCTACG
GTGCAGATCCGGCCATCATCAAAGCACTAGCAAACACTGGGGTCGGTATT
GTAATTGGCGCTTCCAGTGGAGATATTCCGGCTCTCGCTTCTGATCCCAA
CGCCGCTACTCAGTGGATCAACTCAAACGTGTTGCCTTTTTACCCCGCCA
GCAAAATCATTCTCATCACCGTTGGGAATGAGGTGATGATATCAAACGAC
CAAAATCTAATCAGTCAGCTTCTCCCGGCAATGACAAATATGCAAAACGC
TCTCAA
back to top