CX290869

Overview
NameCX290869
Unique NameCX290869
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length455
Libraries
Library NameType
OF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX290869 vs. ExPASy Swiss-Prot
Match: XYLL2_ARATH (D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 4.366e-40
Identity = 77/117 (65.81%), Postives = 95/117 (81.20%), Query Frame = 2
Query:  104 GGYGIGSLLVDLVAGWRYMYGASTPLAVIMGMGMWWLPASPRWLLLCAMKRKGDMQDLRESAISCLCRLRGQSIGDSAPTEVDEILTELSYVGEDKEVSLREVFHGKCLKALIIGAG 454
            GGYGIGSL V++ +GWRYMY  S PLAVIMG+GMWWLPASPRWLLL  ++ KG++++ RE+AI  LC LRG +  DSA  +V+EIL EL++VGEDKEV+  E+F GKCLKALIIG G
Sbjct:  195 GGYGIGSLTVNVHSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLLRVIQGKGNVENQREAAIKSLCCLRGPAFVDSAAEQVNEILAELTFVGEDKEVTFGELFQGKCLKALIIGGG 311          
BLAST of CX290869 vs. ExPASy Swiss-Prot
Match: XYLL1_ARATH (D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 6.524e-36
Identity = 72/128 (56.25%), Postives = 92/128 (71.88%), Query Frame = 2
Query:   71 MRYFKSRFFFQGGYGIGSLLVDLVAGWRYMYGASTPLAVIMGMGMWWLPASPRWLLLCAMKRKGDMQDLRESAISCLCRLRGQSIGDSAPTEVDEILTELSYVGEDKEVSLREVFHGKCLKALIIGAG 454
            ++ F +     GGYGIGSL + +++GWRYMY    P  VIMG GM WLPASPRWLLL A++ +G+ ++L+++AI  LCRLRG  I DSA  +V+EIL ELS VGEDKE +  E+F GKCLKAL I  G
Sbjct:  184 LKEFSTVLGMVGGYGIGSLWITVISGWRYMYATILPFPVIMGTGMCWLPASPRWLLLRALQGQGNGENLQQAAIRSLCRLRGSVIADSAAEQVNEILAELSLVGEDKEATFGELFRGKCLKALTIAGG 311          
BLAST of CX290869 vs. ExPASy Swiss-Prot
Match: XYLL3_ARATH (D-xylose-proton symporter-like 3 OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 6.766e-25
Identity = 57/119 (47.90%), Postives = 79/119 (66.39%), Query Frame = 2
Query:  107 GYGIGSLLVDLVAGWRYMYGASTPLAVIMGMGMWWLPASPRWLLLCAMKRKGDMQDLRESAISCLCRLRGQSIGDSAPTE-VDE--ILTELSYVGEDKEVSLREVFHGKCLKALIIGAG 454
            G+ +GS  +D+V GWRYMYG  TP+A++MG+GMW LPASPRWLLL A++ KG +Q+ +E A+  L +LRG+  GD    + VD+  +  + +Y  E    +  EVF G  LKAL IG G
Sbjct:  247 GFSVGSFQIDVVGGWRYMYGFGTPVALLMGLGMWSLPASPRWLLLRAVQGKGQLQEYKEKAMLALSKLRGRPPGDKISEKLVDDAYLSVKTAYEDEKSGGNFLEVFQGPNLKALTIGGG 365          
The following BLAST results are available for this feature:
BLAST of CX290869 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
XYLL2_ARATH4.366e-4065.81D-xylose-proton symporter-like 2 OS=Arabidopsis th... [more]
XYLL1_ARATH6.524e-3656.25D-xylose-proton symporter-like 1 OS=Arabidopsis th... [more]
XYLL3_ARATH6.766e-2547.90D-xylose-proton symporter-like 3 OS=Arabidopsis th... [more]
back to top
Properties
Property NameValue
Genbank descriptionC03001B03Rv OF1 Citrus clementina cDNA clone C03001B03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX290869 ID=CX290869|Name=CX290869|organism=Citrus clementina|type=EST|length=455bp
CAGCCAACCATGGTTGCCTTCAATCTTCTGTTCTCTTCTTTTGCTAAATC
TTGCCTCAATAATTTTTTTGATGAGATATTTTAAGAGTAGATTTTTCTTT
CAGGGTGGTTATGGTATTGGAAGCCTTTTAGTTGATTTAGTTGCTGGTTG
GCGCTACATGTATGGAGCTAGTACTCCTTTGGCAGTGATTATGGGAATGG
GAATGTGGTGGCTTCCAGCATCTCCTAGATGGCTACTTTTATGTGCCATG
AAGAGAAAAGGAGATATGCAGGATTTGAGAGAGTCCGCAATAAGTTGCTT
GTGCCGTCTCAGGGGTCAATCTATTGGTGACTCTGCTCCTACAGAAGTGG
ATGAGATTCTTACAGAGCTCTCTTATGTTGGAGAAGACAAAGAAGTTTCA
CTAAGGGAAGTATTCCATGGAAAATGCTTGAAGGCCCTTATAATTGGTGC
AGGAT
back to top