CX290877

Overview
NameCX290877
Unique NameCX290877
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length498
Libraries
Library NameType
OF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX290877_ssr309 microsatellite CX290877_ssr309:309..320. BLAST: Citrus ESTs to Prunus persica proteins V1
CX290877_ssr328 microsatellite CX290877_ssr328:328..339. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig11229 contig Ccv1_Contig11229:203..700. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX290877 vs. ExPASy Swiss-Prot
Match: EF1B2_ARATH (Elongation factor 1-beta 2 OS=Arabidopsis thaliana GN=At5g19510 PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 7.938e-31
Identity = 70/154 (45.45%), Postives = 89/154 (57.79%), Query Frame = 2
Query:   35 MAITFSDLHTESGLKSLDQYLSGKSYISGNQLTKDDIKVYAAVLVKPADSFPNASRWYDSVSSHIAPSFPGKAVGVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLLDVKPWDDETDMKKL 496
            MA+TFSDLHTE G+KS++++L+GK+YISG+QL+ DD+KVYAAV VKP+D+FPNAS+WY+SV+S +A SFPGKAVGV+                                                            VL+DVKPWDDETDMKKL
Sbjct:    1 MAVTFSDLHTEEGVKSVEEHLAGKTYISGDQLSVDDVKVYAAVPVKPSDAFPNASKWYESVASQLAKSFPGKAVGVQFGGSAAAAPAVEAEAPAAAADDDDDMDLFGDETEEEKKAAEEREAAKKDTKKPKESGKSSVLMDVKPWDDETDMKKL 154          
BLAST of CX290877 vs. ExPASy Swiss-Prot
Match: EF1B_ORYSJ (Elongation factor 1-beta OS=Oryza sativa subsp. japonica GN=Os07g0662500 PE=1 SV=3)

HSP 1 Score: 123.635 bits (309), Expect = 4.816e-28
Identity = 67/154 (43.51%), Postives = 82/154 (53.25%), Query Frame = 2
Query:   35 MAITFSDLHTESGLKSLDQYLSGKSYISGNQLTKDDIKVYAAVLVKPADSFPNASRWYDSVSSHIAPSFPGKAVGVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLLDVKPWDDETDMKKL 496
            MA+TF+DLHT  GLK+L+Q+LSGK+Y+SGN ++KDDIKV+AAV  KP   FPNA+RWYD+V++ +A  FPGKAVGV                                                             VLLDVKPWDDETDMKKL
Sbjct:    1 MAVTFTDLHTADGLKALEQHLSGKTYVSGNAISKDDIKVFAAVPSKPGAEFPNAARWYDTVAAALASRFPGKAVGVNLPGGGAASSAAAAAPAAKDADEDDDDLDLFGDETEEDKKAADERAASKASSKKKESGKSSVLLDVKPWDDETDMKKL 154          
BLAST of CX290877 vs. ExPASy Swiss-Prot
Match: EF1B1_ARATH (Elongation factor 1-beta 1 OS=Arabidopsis thaliana GN=At5g12110 PE=2 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 6.290e-28
Identity = 56/77 (72.73%), Postives = 69/77 (89.61%), Query Frame = 2
Query:   35 MAITFSDLHTESGLKSLDQYLSGKSYISGNQLTKDDIKVYAAVLVKPADSFPNASRWYDSVSSHIAPSFPGKAVGVR 265
            MA+TFSDLHTE GLK+L+++L+GK+YISG+QL+ DD+KVYAAVL  P D FPNAS+WYDSV+SH+A SFPGKA GVR
Sbjct:    1 MAVTFSDLHTERGLKTLEEHLAGKTYISGDQLSVDDVKVYAAVLENPGDGFPNASKWYDSVASHLAKSFPGKADGVR 77          
BLAST of CX290877 vs. ExPASy Swiss-Prot
Match: EF1B_WHEAT (Elongation factor 1-beta OS=Triticum aestivum PE=1 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 1.773e-22
Identity = 46/76 (60.53%), Postives = 65/76 (85.53%), Query Frame = 2
Query:   35 MAITFSDLHTESGLKSLDQYLSGKSYISGNQLTKDDIKVYAAVLVKPADSFPNASRWYDSVSSHIAPSFPGKAVGV 262
            MA+TFSDLHT  GLK+L+ +L+GK+YISG+ +TKDD+KV+AAV +KP+  FPNA+RWYD+V++ ++  FPG+A GV
Sbjct:    1 MAVTFSDLHTADGLKALEAHLAGKTYISGDGITKDDVKVFAAVPLKPSAEFPNAARWYDTVAAAVSSRFPGQASGV 76          
BLAST of CX290877 vs. ExPASy Swiss-Prot
Match: EF1D_PIMBR (Elongation factor 1-delta OS=Pimpinella brachycarpa PE=2 SV=3)

HSP 1 Score: 72.0182 bits (175), Expect = 1.663e-12
Identity = 32/63 (50.79%), Postives = 46/63 (73.02%), Query Frame = 2
Query:   35 MAITFSDLHTESGLKSLDQYLSGKSYISGNQLTKDDIKVYAAVLVKPADSFPNASRWYDSVSS 223
            MA+TF DL +E+GL+ LD+YL  +SYISG Q +KDD+ V+AA+   P+  + N SRWY+ V +
Sbjct:    1 MAVTFYDLSSEAGLEKLDEYLLSRSYISGYQASKDDLAVHAALAKPPSSKYVNVSRWYNHVEA 63          
BLAST of CX290877 vs. ExPASy Swiss-Prot
Match: EF1D2_ORYSJ (Elongation factor 1-delta 2 OS=Oryza sativa subsp. japonica GN=Os03g0406200 PE=2 SV=3)

HSP 1 Score: 70.0922 bits (170), Expect = 6.319e-12
Identity = 32/68 (47.06%), Postives = 50/68 (73.53%), Query Frame = 2
Query:   35 MAITFSDLHTESGLKSLDQYLSGKSYISGNQLTKDDIKVYAAVLVKPADSFPNASRWYDSVSSHIAPS 238
            MAIT S++++E+GL+ LD+YL  +SYISG Q +KDD+ V+ ++   PA S+ N +RWYD +S+ +  S
Sbjct:    1 MAITLSNVNSEAGLQKLDEYLLTRSYISGYQASKDDMTVFTSLPSAPAASYVNVTRWYDHISALLRSS 68          
The following BLAST results are available for this feature:
BLAST of CX290877 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
EF1B2_ARATH7.938e-3145.45Elongation factor 1-beta 2 OS=Arabidopsis thaliana... [more]
EF1B_ORYSJ4.816e-2843.51Elongation factor 1-beta OS=Oryza sativa subsp. ja... [more]
EF1B1_ARATH6.290e-2872.73Elongation factor 1-beta 1 OS=Arabidopsis thaliana... [more]
EF1B_WHEAT1.773e-2260.53Elongation factor 1-beta OS=Triticum aestivum PE=1... [more]
EF1D_PIMBR1.663e-1250.79Elongation factor 1-delta OS=Pimpinella brachycarp... [more]
EF1D2_ORYSJ6.319e-1247.06Elongation factor 1-delta 2 OS=Oryza sativa subsp.... [more]
back to top
Properties
Property NameValue
Genbank descriptionC03001C01Rv OF1 Citrus clementina cDNA clone C03001C01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX290877 ID=CX290877|Name=CX290877|organism=Citrus clementina|type=EST|length=498bp
TGCGCATCTTCTTGCCTCTGCCTTGAAGACTAAAATGGCCATCACCTTTT
CAGATCTCCACACAGAGTCAGGCCTTAAGTCTCTTGATCAGTATCTTTCT
GGGAAATCTTATATCTCCGGTAATCAACTGACAAAAGATGACATCAAGGT
CTACGCTGCCGTTTTGGTGAAACCTGCTGATTCTTTCCCCAACGCCAGCA
GGTGGTACGACAGCGTTTCTTCACATATCGCCCCAAGCTTCCCTGGCAAA
GCCGTTGGTGTGAGAGTTGATGGCAAAGGTGCTCCAGTTGACGCCGCCGC
AGCCAAGCCTGCTGCTGCTGGAGGTGGTGATGATGATGATTTGGATCTCT
TCGGAGATGAGACTGAGGAGGATAAGAAAGCAGCAGAGGAGAGGGAGGCT
GCTAAAAAGCAATCATCCAAGAAGAAAGAGAGTGGAAAATCATCGGTACT
TTTGGATGTAAAGCCTTGGGATGACGAGACAGACATGAAAAAGCTAGA
back to top