CX290884

Overview
NameCX290884
Unique NameCX290884
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length535
Libraries
Library NameType
OF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig8343 contig Ccv1_Contig8343:1019..1553. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX290884 vs. ExPASy Swiss-Prot
Match: TDT_ARATH (Tonoplast dicarboxylate transporter OS=Arabidopsis thaliana GN=TDT PE=2 SV=2)

HSP 1 Score: 303.138 bits (775), Expect = 5.347e-82
Identity = 149/178 (83.71%), Postives = 163/178 (91.57%), Query Frame = 2
Query:    2 MTRSITDDIPGWGALFNDRAGDGTASVVMATLLFIIPSMKQKGEKLMDWNKCKKLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFTSNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQDMIKTG 535
            MTR+ITDDIPGWG +F  RAGDGT SV+MATLLFIIPS  +KGEKLMDWNKCKKLPWNI+LLLGAGFAIADGVRTSGLA+ LSK L FLE APY AIAP VCLI+A ITEFTSNNATTTL++PLLI+IAK M +HPLLLMVPGAIGAQF+FLLPTGTPSN+VGFTTGHIEI+DMIKTG
Sbjct:  334 MTRNITDDIPGWGRIFAGRAGDGTVSVMMATLLFIIPSNIKKGEKLMDWNKCKKLPWNIVLLLGAGFAIADGVRTSGLAEVLSKGLVFLETAPYWAIAPTVCLIAATITEFTSNNATTTLLVPLLIEIAKNMGIHPLLLMVPGAIGAQFAFLLPTGTPSNVVGFTTGHIEIKDMIKTG 511          
BLAST of CX290884 vs. ExPASy Swiss-Prot
Match: S13A3_MOUSE (Solute carrier family 13 member 3 OS=Mus musculus GN=Slc13a3 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.290e-35
Identity = 76/185 (41.08%), Postives = 108/185 (58.38%), Query Frame = 2
Query:   26 IPGWGALFNDR-AGDGTASVVMATLLFIIPSMK-------------QKGEKLMDWNKCKK-LPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFTSNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQDMIKTG 535
            IPGW +LF      D    V + T+LF  PS K              + E L+ W K ++ +PWNIILLLG GFA+A G   SGL+  +   L  LE  P L    ++ ++ A  TEF SN AT  + LP+L ++A  +HVHPL LM+PG +G  ++F+LP  TP N + F+TGH+ ++DM++TG
Sbjct:  362 IPGWASLFAPGFVSDAVTGVAIVTILFFFPSQKPSLKWWFDFKAPNSETEPLLSWKKAQETVPWNIILLLGGGFAMAKGCEESGLSAWIGGQLHPLEHVPPLLAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLHVHPLYLMIPGTVGCSYAFMLPVSTPPNSIAFSTGHLLVKDMVRTG 546          
BLAST of CX290884 vs. ExPASy Swiss-Prot
Match: S13A3_RAT (Solute carrier family 13 member 3 OS=Rattus norvegicus GN=Slc13a3 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 6.404e-35
Identity = 75/185 (40.54%), Postives = 107/185 (57.84%), Query Frame = 2
Query:   26 IPGWGALFNDR-AGDGTASVVMATLLFIIPSMK-------------QKGEKLMDWNKCKK-LPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFTSNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQDMIKTG 535
            IPGW +LF      D    V + T+LF  PS K              + E L+ W K ++ +PWNIILLLG GFA+A G   SGL+  +   L  LE  P L    ++ ++ A  TEF SN AT  + LP+L ++A  +HVHPL LM+PG +   ++F+LP  TP N + F+TGH+ ++DM++TG
Sbjct:  362 IPGWASLFAPGFVSDAVTGVAIVTILFFFPSQKPSLKWWFDFKAPNSETEPLLSWKKAQETVPWNIILLLGGGFAMAKGCEESGLSAWIGGQLHPLEHVPPLLAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLHVHPLYLMIPGTVSCSYAFMLPVSTPPNSIAFSTGHLLVKDMVRTG 546          
BLAST of CX290884 vs. ExPASy Swiss-Prot
Match: S13A3_HUMAN (Solute carrier family 13 member 3 OS=Homo sapiens GN=SLC13A3 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 5.422e-34
Identity = 74/185 (40.00%), Postives = 106/185 (57.30%), Query Frame = 2
Query:   26 IPGWGALFNDR-AGDGTASVVMATLLFIIPSMKQ-------------KGEKLMDWNKCKK-LPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFTSNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQDMIKTG 535
            IPGW +LFN     D    V + T+LF  PS +              + E L+ W K ++ +PWNIILLLG GFA+A G   SGL+  +   L  LE  P      ++ ++ A  TEF SN AT  + LP+L ++A  + VHPL LM+PG +G  F+F+LP  TP N + F +GH+ ++DM++TG
Sbjct:  364 IPGWASLFNPGFLSDAVTGVAIVTILFFFPSQRPSLKWWFDFKAPNTETEPLLTWKKAQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVPPALAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLRVHPLYLMIPGTVGCSFAFMLPVSTPPNSIAFASGHLLVKDMVRTG 548          
BLAST of CX290884 vs. ExPASy Swiss-Prot
Match: SDCS_STAS1 (Sodium-dependent dicarboxylate transporter sdcS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=sdcS PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 9.248e-34
Identity = 67/164 (40.85%), Postives = 103/164 (62.80%), Query Frame = 2
Query:   47 FNDRAGDGTASVVMATLLFIIPSM-KQKGEKLMDWNKCKKLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFTSNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQDMIKTG 535
            F     DGT ++ ++ LLF+IP+  K+K ++++DW   K LPW +++L G G A+A G+  SGLA+ L + L  +E    L I  ++ +    +TE TSN AT T++LP+L  ++  ++VHPLLLMVP A+ A  +++LP GTP N + F TG I I+ M   G
Sbjct:  322 FTSEVADGTIAMFISVLLFLIPAKNKEKHKRIIDWEVAKDLPWGVLILFGGGLALAKGISESGLANWLGEQLKLIEGVSPLVIVLVITIFVLFLTEITSNTATATMILPILATLSVAVNVHPLLLMVPAAMAANCAYMLPVGTPPNAIVFGTGKISIKKMASVG 485          
BLAST of CX290884 vs. ExPASy Swiss-Prot
Match: S13A5_HUMAN (Solute carrier family 13 member 5 OS=Homo sapiens GN=SLC13A5 PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 7.829e-33
Identity = 76/192 (39.58%), Postives = 112/192 (58.33%), Query Frame = 2
Query:   26 IPGWGALF-----NDRAGDGTASVVMATLLFIIPSMKQKGE----------------KLMDWNKCK-KLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFTSNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQDMIKTG 535
            +PGW  +           D T ++ +ATLLFI+PS K K                   L+DW   + K+PW I+LLLG GFA+A G   SGL+  + K ++ L A P  AI  I+ L+ A+ TE TSN ATTTL LP+   +++++ ++PL +M+P  + A F+F+LP  TP N + FT GH+++ DM+KTG
Sbjct:  338 MPGWLTVAWVEGETKYVSDATVAIFVATLLFIVPSQKPKFNFRSQTEEERKTPFYPPPLLDWKVTQEKVPWGIVLLLGGGFALAKGSEASGLSVWMGKQMEPLHAVPPAAITLILSLLVAVFTECTSNVATTTLFLPIFASMSRSIGLNPLYIMLPCTLSASFAFMLPVATPPNAIVFTYGHLKVADMVKTG 529          
BLAST of CX290884 vs. ExPASy Swiss-Prot
Match: S13A2_RAT (Solute carrier family 13 member 2 OS=Rattus norvegicus GN=Slc13a2 PE=2 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 1.250e-30
Identity = 75/189 (39.68%), Postives = 112/189 (59.26%), Query Frame = 2
Query:   29 PGWG-ALFNDRAG-----DGTASVVMATLLFIIPSM--------KQKGE-----KLMDWNKCK-KLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFTSNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQDMIKTG 535
            PGWG  +F +  G     DGT ++ ++ ++FIIPS         K+ G+      ++ W     K+PWNI++LLG GFA+A G   SGL++ L   L  L+  P  A A I+CL+ AI TE TSN ATTTL LP+L  +A+ + +HPL +M+P  + A  +F+LP  TP N + F+ G +++ DM + G
Sbjct:  347 PGWGDTVFANEKGQSMPSDGTVAIFISLVMFIIPSKIPGLMEDPKKPGKLKAPPAILTWKTVNDKMPWNIVILLGGGFALAKGSEQSGLSEWLGDKLTPLQHIPPSATAVILCLLIAIFTECTSNVATTTLFLPILASMAQAICLHPLYVMLPCTLAASLAFMLPVATPPNAIVFSFGGLKVSDMARAG 535          
BLAST of CX290884 vs. ExPASy Swiss-Prot
Match: SDCS_STAAR (Sodium-dependent dicarboxylate transporter sdcS OS=Staphylococcus aureus (strain MRSA252) GN=sdcS PE=3 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 2.132e-30
Identity = 63/158 (39.87%), Postives = 97/158 (61.39%), Query Frame = 2
Query:   65 DGTASVVMATLLFIIPSMK-QKGEKLMDWNKCKKLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFTSNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQDMIKTG 535
            DGT ++ ++ LLFIIP+   +K  +++DW   K+LPW +++L G G A+A G+  SGLA  L + L  L     + I  ++ +    +TE TSN AT T++LP+L  ++  + VHPLLLM P A+ A  +++LP GTP N + F +G I I+ M   G
Sbjct:  329 DGTIAIFISILLFIIPAKNTEKHRRIIDWEVAKELPWGVLILFGGGLALAKGISESGLAKWLGEQLKSLNGVSPILIVIVITIFVLFLTEVTSNTATATMILPILATLSVAVGVHPLLLMAPAAMAANCAYMLPVGTPPNAIIFGSGKISIKQMASVG 486          
BLAST of CX290884 vs. ExPASy Swiss-Prot
Match: SDCS_STAAN (Sodium-dependent dicarboxylate transporter sdcS OS=Staphylococcus aureus (strain N315) GN=sdcS PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 2.132e-30
Identity = 63/158 (39.87%), Postives = 97/158 (61.39%), Query Frame = 2
Query:   65 DGTASVVMATLLFIIPSMK-QKGEKLMDWNKCKKLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFTSNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQDMIKTG 535
            DGT ++ ++ LLFIIP+   +K  +++DW   K+LPW +++L G G A+A G+  SGLA  L + L  L     + I  ++ +    +TE TSN AT T++LP+L  ++  + VHPLLLM P A+ A  +++LP GTP N + F +G I I+ M   G
Sbjct:  329 DGTIAIFISILLFIIPAKNTEKHRRIIDWEVAKELPWGVLILFGGGLALAKGISESGLAKWLGEQLKSLNGVSPILIVIVITIFVLFLTEVTSNTATATMILPILATLSVAVGVHPLLLMAPAAMAANCAYMLPVGTPPNAIIFGSGKISIKQMASVG 486          
BLAST of CX290884 vs. ExPASy Swiss-Prot
Match: SDCS_STAAM (Sodium-dependent dicarboxylate transporter sdcS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=sdcS PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 2.132e-30
Identity = 63/158 (39.87%), Postives = 97/158 (61.39%), Query Frame = 2
Query:   65 DGTASVVMATLLFIIPSMK-QKGEKLMDWNKCKKLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFTSNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQDMIKTG 535
            DGT ++ ++ LLFIIP+   +K  +++DW   K+LPW +++L G G A+A G+  SGLA  L + L  L     + I  ++ +    +TE TSN AT T++LP+L  ++  + VHPLLLM P A+ A  +++LP GTP N + F +G I I+ M   G
Sbjct:  329 DGTIAIFISILLFIIPAKNTEKHRRIIDWEVAKELPWGVLILFGGGLALAKGISESGLAKWLGEQLKSLNGVSPILIVIVITIFVLFLTEVTSNTATATMILPILATLSVAVGVHPLLLMAPAAMAANCAYMLPVGTPPNAIIFGSGKISIKQMASVG 486          
The following BLAST results are available for this feature:
BLAST of CX290884 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
TDT_ARATH5.347e-8283.71Tonoplast dicarboxylate transporter OS=Arabidopsis... [more]
S13A3_MOUSE1.290e-3541.08Solute carrier family 13 member 3 OS=Mus musculus ... [more]
S13A3_RAT6.404e-3540.54Solute carrier family 13 member 3 OS=Rattus norveg... [more]
S13A3_HUMAN5.422e-3440.00Solute carrier family 13 member 3 OS=Homo sapiens ... [more]
SDCS_STAS19.248e-3440.85Sodium-dependent dicarboxylate transporter sdcS OS... [more]
S13A5_HUMAN7.829e-3339.58Solute carrier family 13 member 5 OS=Homo sapiens ... [more]
S13A2_RAT1.250e-3039.68Solute carrier family 13 member 2 OS=Rattus norveg... [more]
SDCS_STAAR2.132e-3039.87Sodium-dependent dicarboxylate transporter sdcS OS... [more]
SDCS_STAAN2.132e-3039.87Sodium-dependent dicarboxylate transporter sdcS OS... [more]
SDCS_STAAM2.132e-3039.87Sodium-dependent dicarboxylate transporter sdcS OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC03001C09Rv OF1 Citrus clementina cDNA clone C03001C09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX290884 ID=CX290884|Name=CX290884|organism=Citrus clementina|type=EST|length=535bp
GATGACAAGATCAATAACAGATGACATTCCAGGTTGGGGAGCACTCTTCA
ATGACCGTGCTGGTGATGGAACTGCTAGTGTTGTGATGGCAACATTGTTG
TTCATAATTCCGAGCATGAAGCAAAAGGGAGAAAAATTGATGGATTGGAA
CAAATGCAAGAAGCTACCTTGGAACATTATATTGCTTTTAGGGGCTGGCT
TTGCTATAGCTGATGGAGTCAGGACTAGCGGTCTTGCTGATGATCTGTCA
AAAGCATTGGATTTCCTGGAGGCGGCGCCATATTTAGCCATTGCACCTAT
CGTATGTCTGATTAGCGCGATTATTACTGAATTCACATCAAATAATGCCA
CAACAACTCTCGTTCTTCCACTTCTGATCCAAATAGCAAAAACTATGCAT
GTTCATCCATTGCTTCTTATGGTTCCTGGAGCAATTGGAGCACAATTTTC
TTTCTTGTTGCCGACTGGAACCCCTTCAAATATTGTTGGATTCACAACCG
GGCACATCGAAATTCAAGATATGATCAAGACAGGG
back to top