CX293881

Overview
NameCX293881
Unique NameCX293881
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length524
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15451 contig Ccv1_Contig15451:301..824. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX293881 vs. ExPASy Swiss-Prot
Match: SEH1_XENTR (Nucleoporin seh1 OS=Xenopus tropicalis GN=seh1l PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.177e-12
Identity = 48/171 (28.07%), Postives = 77/171 (45.03%), Query Frame = 1
Query:   28 LWEEIVEDAQPL-----QWKLCKSFESTSTQVLDVQFGVSSTSLKLVAAYSDGHVKVYELLDPLILKNWQLQAEFQNAIDSVTMFRKASCISASISWNPQKGENQGSSFVLGFNSDTPQ-LNSSKVWEFDEAHNRWLPVAELALPEDRSDEVYAVAWALNIGRPYEVIAVA 522
            +WEEIV ++         W    +   + T V DV+F      L L    +DG V++YE  D + L  W LQ E            K SC  + ISWNP           +G +  +P  +   +++E++E   ++     L      SD V+ +A+A N+GR + ++AVA
Sbjct:   85 VWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGVVRIYEAPDVMNLSQWSLQHEIS---------CKLSC--SCISWNPSSSRAHSPMIAVGSDDSSPNIMGKVQIYEYNENTRKYAKAETLM---SVSDPVHDIAFAPNLGRSFHILAVA 241          
BLAST of CX293881 vs. ExPASy Swiss-Prot
Match: SEH1B_XENLA (Nucleoporin seh1-B OS=Xenopus laevis GN=seh1l-B PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.177e-12
Identity = 48/171 (28.07%), Postives = 77/171 (45.03%), Query Frame = 1
Query:   28 LWEEIVEDAQPL-----QWKLCKSFESTSTQVLDVQFGVSSTSLKLVAAYSDGHVKVYELLDPLILKNWQLQAEFQNAIDSVTMFRKASCISASISWNPQKGENQGSSFVLGFNSDTPQ-LNSSKVWEFDEAHNRWLPVAELALPEDRSDEVYAVAWALNIGRPYEVIAVA 522
            +WEEIV ++         W    +   + T V DV+F      L L    +DG V++YE  D + L  W LQ E            K SC  + ISWNP           +G +  +P  +   +++E++E   ++     L      SD V+ +A+A N+GR + ++AVA
Sbjct:   85 VWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGVVRIYEAPDVMNLSQWSLQHEIS---------CKLSC--SCISWNPSSSRAHSPMIAVGSDDSSPNIMGKVQIYEYNENTRKYAKAETLM---SVSDPVHDIAFAPNLGRSFHILAVA 241          
BLAST of CX293881 vs. ExPASy Swiss-Prot
Match: SEH1A_XENLA (Nucleoporin seh1-A OS=Xenopus laevis GN=seh1l-A PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.177e-12
Identity = 48/171 (28.07%), Postives = 77/171 (45.03%), Query Frame = 1
Query:   28 LWEEIVEDAQPL-----QWKLCKSFESTSTQVLDVQFGVSSTSLKLVAAYSDGHVKVYELLDPLILKNWQLQAEFQNAIDSVTMFRKASCISASISWNPQKGENQGSSFVLGFNSDTPQ-LNSSKVWEFDEAHNRWLPVAELALPEDRSDEVYAVAWALNIGRPYEVIAVA 522
            +WEEIV ++         W    +   + T V DV+F      L L    +DG V++YE  D + L  W LQ E            K SC  + ISWNP           +G +  +P  +   +++E++E   ++     L      SD V+ +A+A N+GR + ++AVA
Sbjct:   85 VWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGVVRIYEAPDVMNLSQWSLQHEIS---------CKLSC--SCISWNPSSSRAHSPMIAVGSDDSSPNIMGKVQIYEYNENTRKYAKAETLM---SVSDPVHDIAFAPNLGRSFHILAVA 241          
BLAST of CX293881 vs. ExPASy Swiss-Prot
Match: SEH1_OSMMO (Nucleoporin seh1 OS=Osmerus mordax GN=seh1l PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.599e-11
Identity = 50/171 (29.24%), Postives = 78/171 (45.61%), Query Frame = 1
Query:   28 LWEEIVEDAQPLQ-----WKLCKSFESTSTQVLDVQFGVSSTSLKLVAAYSDGHVKVYELLDPLILKNWQLQAEFQNAIDSVTMFRKASCISASISWNPQKGENQGSSFVLGF-NSDTPQLNSSKVWEFDEAHNRWLPVAELALPEDRSDEVYAVAWALNIGRPYEVIAVA 522
            +WEEIV ++   Q     W    +   + T V DV+F      L L    +DG V++YE  D + L  W LQ E            K SC  + ISWNP           +G  +S+T      +++E+ E   ++  V  L      +D V+ +A+A N+GR + V+A+A
Sbjct:   85 VWEEIVGESNDKQRGLSHWIKRTTLVDSRTSVTDVKFAPKHMGLMLTTCSADGVVRIYEAPDVMNLSQWSLQHEIS---------CKLSC--SCISWNPSSSRAHSPMIAVGSDDSNTAYSGKVQIYEYVENTRKYAKVETLMTV---TDPVHDIAFAPNLGRSFHVLAIA 241          
BLAST of CX293881 vs. ExPASy Swiss-Prot
Match: SEH1_PONAB (Nucleoporin SEH1 OS=Pongo abelii GN=SEH1L PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.652e-11
Identity = 46/171 (26.90%), Postives = 77/171 (45.03%), Query Frame = 1
Query:   28 LWEEIVEDAQPL-----QWKLCKSFESTSTQVLDVQFGVSSTSLKLVAAYSDGHVKVYELLDPLILKNWQLQAEFQNAIDSVTMFRKASCISASISWNPQKGENQGSSFVLGFNSDTPQ-LNSSKVWEFDEAHNRWLPVAELALPEDRSDEVYAVAWALNIGRPYEVIAVA 522
            +WEEIV ++         W    +   + T V DV+F      L L    +DG V++YE  D + L  W LQ E            K SC  + ISWNP           +G +  +P  +   +++E++E   ++     L      +D V+ +A+A N+GR + ++A+A
Sbjct:   85 VWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEIS---------CKLSC--SCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTV---TDPVHDIAFAPNLGRSFHILAIA 241          
BLAST of CX293881 vs. ExPASy Swiss-Prot
Match: SEH1_HUMAN (Nucleoporin SEH1 OS=Homo sapiens GN=SEH1L PE=1 SV=3)

HSP 1 Score: 67.3958 bits (163), Expect = 4.652e-11
Identity = 46/171 (26.90%), Postives = 77/171 (45.03%), Query Frame = 1
Query:   28 LWEEIVEDAQPL-----QWKLCKSFESTSTQVLDVQFGVSSTSLKLVAAYSDGHVKVYELLDPLILKNWQLQAEFQNAIDSVTMFRKASCISASISWNPQKGENQGSSFVLGFNSDTPQ-LNSSKVWEFDEAHNRWLPVAELALPEDRSDEVYAVAWALNIGRPYEVIAVA 522
            +WEEIV ++         W    +   + T V DV+F      L L    +DG V++YE  D + L  W LQ E            K SC  + ISWNP           +G +  +P  +   +++E++E   ++     L      +D V+ +A+A N+GR + ++A+A
Sbjct:   85 VWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEIS---------CKLSC--SCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTV---TDPVHDIAFAPNLGRSFHILAIA 241          
BLAST of CX293881 vs. ExPASy Swiss-Prot
Match: SEH1_BOVIN (Nucleoporin SEH1 OS=Bos taurus GN=SEH1L PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.652e-11
Identity = 46/171 (26.90%), Postives = 77/171 (45.03%), Query Frame = 1
Query:   28 LWEEIVEDAQPL-----QWKLCKSFESTSTQVLDVQFGVSSTSLKLVAAYSDGHVKVYELLDPLILKNWQLQAEFQNAIDSVTMFRKASCISASISWNPQKGENQGSSFVLGFNSDTPQ-LNSSKVWEFDEAHNRWLPVAELALPEDRSDEVYAVAWALNIGRPYEVIAVA 522
            +WEEIV ++         W    +   + T V DV+F      L L    +DG V++YE  D + L  W LQ E            K SC  + ISWNP           +G +  +P  +   +++E++E   ++     L      +D V+ +A+A N+GR + ++A+A
Sbjct:   85 VWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEIS---------CKLSC--SCISWNPSSSRAHAPMIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLLTV---TDPVHDIAFAPNLGRSFHILAIA 241          
The following BLAST results are available for this feature:
BLAST of CX293881 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
SEH1_XENTR7.177e-1228.07Nucleoporin seh1 OS=Xenopus tropicalis GN=seh1l PE... [more]
SEH1B_XENLA7.177e-1228.07Nucleoporin seh1-B OS=Xenopus laevis GN=seh1l-B PE... [more]
SEH1A_XENLA7.177e-1228.07Nucleoporin seh1-A OS=Xenopus laevis GN=seh1l-A PE... [more]
SEH1_OSMMO1.599e-1129.24Nucleoporin seh1 OS=Osmerus mordax GN=seh1l PE=2 S... [more]
SEH1_PONAB4.652e-1126.90Nucleoporin SEH1 OS=Pongo abelii GN=SEH1L PE=2 SV=... [more]
SEH1_HUMAN4.652e-1126.90Nucleoporin SEH1 OS=Homo sapiens GN=SEH1L PE=1 SV=... [more]
SEH1_BOVIN4.652e-1126.90Nucleoporin SEH1 OS=Bos taurus GN=SEH1L PE=2 SV=1[more]
back to top
Libraries
Library NameType
FlavRip1cdna_library
Properties
Property NameValue
Genbank descriptionC05002A09SK FlavRip1 Citrus clementina cDNA clone C05002A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293881 ID=CX293881|Name=CX293881|organism=Citrus clementina|type=EST|length=524bp
TGGCCTCGTGCCGGCACGAGGTTGTTGTTGTGGGAAGAGATTGTTGAAGA
TGCACAGCCTCTGCAGTGGAAGCTCTGTAAGAGCTTTGAAAGCACTTCGA
CTCAAGTGTTAGATGTTCAATTTGGAGTCTCTTCCACAAGTTTGAAATTG
GTTGCTGCATACTCAGATGGCCATGTTAAAGTTTATGAGCTCCTAGATCC
CTTGATACTGAAAAATTGGCAACTTCAGGCTGAATTTCAGAATGCTATTG
ATTCTGTGACTATGTTTAGGAAGGCTTCATGCATATCGGCATCCATTTCT
TGGAATCCACAGAAGGGTGAAAACCAGGGATCTAGTTTTGTTCTCGGGTT
CAATTCAGACACACCACAACTCAATTCCTCCAAGGTATGGGAGTTTGATG
AGGCTCATAATAGATGGCTACCAGTGGCAGAGTTGGCTTTGCCTGAGGAC
AGGAGTGATGAGGTTTATGCTGTAGCATGGGCACTAAACATCGGCCGGCC
ATATGAGGTGATAGCTGTTGCAAC
back to top