CX293885

Overview
NameCX293885
Unique NameCX293885
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length445
Libraries
Library NameType
FlavRip1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14397 contig Ccv1_Contig14397:153..597. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX293885 vs. ExPASy Swiss-Prot
Match: FABZ_GEOMG ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=fabZ PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.784e-11
Identity = 31/46 (67.39%), Postives = 37/46 (80.43%), Query Frame = 1
Query:  307 TVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFF 444
            TV DIN+I  ILPHR+PFLLVDR++E+ PG   V IKNVTIN+ FF
Sbjct:    3 TVFDINEIMKILPHRYPFLLVDRIVEHVPGERIVGIKNVTINEPFF 48          
BLAST of CX293885 vs. ExPASy Swiss-Prot
Match: FABZ_SYNJA ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Synechococcus sp. (strain JA-3-3Ab) GN=fabZ PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.974e-11
Identity = 30/47 (63.83%), Postives = 36/47 (76.60%), Query Frame = 1
Query:  304 PTVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFF 444
            P V   +QI +ILPHR+PFLLVDRV+EY PG  AV +KNVT N+ FF
Sbjct:   23 PPVFTTDQILEILPHRYPFLLVDRVVEYQPGQRAVGLKNVTFNEPFF 69          
BLAST of CX293885 vs. ExPASy Swiss-Prot
Match: FABZ_SYNJB ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Synechococcus sp. GN=fabZ PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 5.190e-11
Identity = 30/47 (63.83%), Postives = 35/47 (74.47%), Query Frame = 1
Query:  304 PTVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFF 444
            P V    QI +ILPHR+PFLLVDRV+EY PG  AV +KNVT N+ FF
Sbjct:   23 PPVFTTEQILEILPHRYPFLLVDRVVEYQPGQRAVGLKNVTFNEPFF 69          
BLAST of CX293885 vs. ExPASy Swiss-Prot
Match: FABZ_GEOUR ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Geobacter uraniireducens (strain Rf4) GN=fabZ PE=3 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 5.190e-11
Identity = 29/44 (65.91%), Postives = 35/44 (79.55%), Query Frame = 1
Query:  313 MDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFF 444
            MDIN+I  ILPHRFPFL+VDR++E  PG   V +KNVTIN+ FF
Sbjct:    1 MDINEIMKILPHRFPFLMVDRIVEMEPGKRCVGLKNVTINEPFF 44          
The following BLAST results are available for this feature:
BLAST of CX293885 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
FABZ_GEOMG1.784e-1167.39(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd... [more]
FABZ_SYNJA3.974e-1163.83(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd... [more]
FABZ_SYNJB5.190e-1163.83(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd... [more]
FABZ_GEOUR5.190e-1165.91(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05002B02SK FlavRip1 Citrus clementina cDNA clone C05002B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293885 ID=CX293885|Name=CX293885|organism=Citrus clementina|type=EST|length=445bp
GCACGAGGTACTCCTCAATTGAATCAATAGAATCCAATCTCTCAGTTCTT
CTCTCTTACAATGGCTACTGCCCCTGCTGCTTCCTTTGCCAATTCACTTT
TATCTCTCAATTCTCATCGACCAAATCCAAATGCCTCTTCTATTTCAAAA
CCCAACACTCTCTCCATCCAATTCGACAAGAAGACGAATCAACAACAACA
GCAGCACCAACGACATGCTCGTTTCACCACATTTTGTTCTTTGGACGCTG
AACCCAAAGATTCCATCGAAGATAAACCCATCGAACTTCGGTACCAGGCA
TTTCCTACAGTGATGGACATTAACCAGATTCGTGACATTTTGCCACACAG
GTTCCCATTTCTTTTGGTGGATAGAGTTATTGAATACAATCCAGGAGTTT
CAGCTGTTGCTATTAAGAATGTTACTATTAATGATAACTTCTTTC
back to top