CX293889

Overview
NameCX293889
Unique NameCX293889
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length201
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11037 contig Ccv1_Contig11037:1725..1925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX293889 vs. ExPASy Swiss-Prot
Match: P5CS_SOLLC (Delta-1-pyrroline-5-carboxylate synthetase OS=Solanum lycopersicum GN=PRO2 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.107e-21
Identity = 45/63 (71.43%), Postives = 53/63 (84.13%), Query Frame = 1
Query:   10 LVVELQHEGVGLFGGPRASQLLKIPETRLFHHEYNSMVCTAEIVDDVRAAIDHIHQHGSAHTD 198
            L+VELQ +GV L+GGP+AS LL IPE R F HEY+S+ CT E+V+DV AAIDHIHQHGSAHTD
Sbjct:  564 LIVELQTKGVSLYGGPKASSLLMIPEARTFRHEYSSLACTVEVVEDVYAAIDHIHQHGSAHTD 626          
BLAST of CX293889 vs. ExPASy Swiss-Prot
Match: P5CS2_ARATH (Delta-1-pyrroline-5-carboxylate synthetase B OS=Arabidopsis thaliana GN=P5CSB PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 8.005e-21
Identity = 45/64 (70.31%), Postives = 51/64 (79.69%), Query Frame = 1
Query:   10 LVVELQHEGVGLFGGPRASQLLKIPETRLFHHEYNSMVCTAEIVDDVRAAIDHIHQHGSAHTDC 201
            L+  LQ +GV L+GGPRAS  L IPET+ FHHEY+S  CT EIV+DV  AIDHIHQHGSAHTDC
Sbjct:  564 LIYVLQTKGVTLYGGPRASAKLNIPETKSFHHEYSSKACTVEIVEDVYGAIDHIHQHGSAHTDC 627          
BLAST of CX293889 vs. ExPASy Swiss-Prot
Match: P5CS_ACTDE (Delta-1-pyrroline-5-carboxylate synthetase OS=Actinidia deliciosa PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.046e-20
Identity = 46/63 (73.02%), Postives = 52/63 (82.54%), Query Frame = 1
Query:   10 LVVELQHEGVGLFGGPRASQLLKIPETRLFHHEYNSMVCTAEIVDDVRAAIDHIHQHGSAHTD 198
            L+VELQ +GV + GGPRAS LL IPE R  HHEY+S+ CT EIVDDV AAIDHIH+HGSAHTD
Sbjct:  564 LIVELQIKGVVIHGGPRASSLLHIPEARSLHHEYSSLACTIEIVDDVYAAIDHIHRHGSAHTD 626          
BLAST of CX293889 vs. ExPASy Swiss-Prot
Match: P5CS1_ARATH (Delta-1-pyrroline-5-carboxylate synthetase A OS=Arabidopsis thaliana GN=P5CSA PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.363e-19
Identity = 41/64 (64.06%), Postives = 50/64 (78.12%), Query Frame = 1
Query:   10 LVVELQHEGVGLFGGPRASQLLKIPETRLFHHEYNSMVCTAEIVDDVRAAIDHIHQHGSAHTDC 201
            L+  LQ  GV L+GGPRAS++L IPE R F+HEY +  CT E+V+DV  AIDHIH+HGSAHTDC
Sbjct:  564 LIFALQSNGVTLYGGPRASKILNIPEARSFNHEYCAKACTVEVVEDVYGAIDHIHRHGSAHTDC 627          
BLAST of CX293889 vs. ExPASy Swiss-Prot
Match: P5CS_VIGAC (Delta-1-pyrroline-5-carboxylate synthetase OS=Vigna aconitifolia PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.719e-18
Identity = 41/63 (65.08%), Postives = 52/63 (82.54%), Query Frame = 1
Query:   10 LVVELQHEGVGLFGGPRASQLLKIPETRLFHHEYNSMVCTAEIVDDVRAAIDHIHQHGSAHTD 198
            ++++L+ EGV L+GGP AS LL IP+   FHHEY+S+ CTAEIVDDV AAIDHI+ +GSAHTD
Sbjct:  565 IILDLRTEGVILYGGPVASSLLNIPQAHSFHHEYSSLACTAEIVDDVYAAIDHINLYGSAHTD 627          
BLAST of CX293889 vs. ExPASy Swiss-Prot
Match: P5CS_ORYSJ (Delta-1-pyrroline-5-carboxylate synthetase OS=Oryza sativa subsp. japonica GN=P5CS PE=2 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 1.413e-17
Identity = 38/64 (59.38%), Postives = 50/64 (78.12%), Query Frame = 1
Query:   10 LVVELQHEGVGLFGGPRASQLLKIPETRLFHHEYNSMVCTAEIVDDVRAAIDHIHQHGSAHTDC 201
            ++V L+ EGV ++GGP A + L  P+   FHHEY+SM CT E VDDV++AIDHIH++GSAHTDC
Sbjct:  564 ILVALKTEGVNIYGGPIAHKALGFPKAVSFHHEYSSMACTVEFVDDVQSAIDHIHRYGSAHTDC 627          
BLAST of CX293889 vs. ExPASy Swiss-Prot
Match: P5CS_MESCR (Delta-1-pyrroline-5-carboxylate synthetase OS=Mesembryanthemum crystallinum GN=P5CS PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.727e-15
Identity = 40/66 (60.61%), Postives = 49/66 (74.24%), Query Frame = 1
Query:   10 LVVELQHEGVGLFGGPR--ASQLLKIPETRLFHHEYNSMVCTAEIVDDVRAAIDHIHQHGSAHTDC 201
            L+V+L+ EGV +FGGPR  A Q   I  T+ F+ EY+S  CT EIVDDV AAI+HI+ HGSAHTDC
Sbjct:  561 LIVDLRTEGVTMFGGPRIDALQEFNIQATQTFNREYSSPACTVEIVDDVYAAIEHINHHGSAHTDC 626          
The following BLAST results are available for this feature:
BLAST of CX293889 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
P5CS_SOLLC2.107e-2171.43Delta-1-pyrroline-5-carboxylate synthetase OS=Sola... [more]
P5CS2_ARATH8.005e-2170.31Delta-1-pyrroline-5-carboxylate synthetase B OS=Ar... [more]
P5CS_ACTDE1.046e-2073.02Delta-1-pyrroline-5-carboxylate synthetase OS=Acti... [more]
P5CS1_ARATH3.363e-1964.06Delta-1-pyrroline-5-carboxylate synthetase A OS=Ar... [more]
P5CS_VIGAC3.719e-1865.08Delta-1-pyrroline-5-carboxylate synthetase OS=Vign... [more]
P5CS_ORYSJ1.413e-1759.38Delta-1-pyrroline-5-carboxylate synthetase OS=Oryz... [more]
P5CS_MESCR1.727e-1560.61Delta-1-pyrroline-5-carboxylate synthetase OS=Mese... [more]
back to top
Libraries
Library NameType
FlavRip1cdna_library
Properties
Property NameValue
Genbank descriptionC05002B07SK FlavRip1 Citrus clementina cDNA clone C05002B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293889 ID=CX293889|Name=CX293889|organism=Citrus clementina|type=EST|length=201bp
GCACGAGGGCTTGTTGTAGAACTTCAACATGAAGGTGTCGGTTTATTTGG
CGGACCAAGAGCAAGTCAATTACTAAAAATTCCTGAGACACGCTTATTCC
ATCATGAGTACAACTCAATGGTTTGTACGGCTGAAATTGTGGACGATGTG
CGTGCTGCTATTGACCATATTCATCAACATGGAAGTGCCCATACTGATTG
C
back to top