CX293891

Overview
NameCX293891
Unique NameCX293891
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length513
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX293891 vs. ExPASy Swiss-Prot
Match: KPYG_TOBAC (Pyruvate kinase isozyme G, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 2.428e-78
Identity = 143/165 (86.67%), Postives = 154/165 (93.33%), Query Frame = 3
Query:   18 GKGVVGPNARRKTKIVCTIGPSTSSREMIWKLAEEGMNVARLNMSHGDHASHQKTIDLVKEYNSQFEDKAVAIMLDTKGPEVRSGDVPQPIILKEGQEFNFTIKRGVSTEDTVSVNYDDFVNDVEVGDILLVDGGMMSLAVKSKTKDLVKCIVVDGGELKSRRHL 512
            G+  V  N+ RKTKIVCTIGPSTSSREMIWKLAE GMNVARLNMSHGDHASHQ+TIDLVKEYN+QFEDK +AIMLDTKGPEV SGDVP+PI+LKEGQEFNF+IKRGVSTEDTVSVNYDDF+NDVE GDILLVDGGMMSLAVKSKT D+VKC V+DGGELKSRRHL
Sbjct:   81 GQESVYLNSPRKTKIVCTIGPSTSSREMIWKLAEAGMNVARLNMSHGDHASHQRTIDLVKEYNAQFEDKVIAIMLDTKGPEVISGDVPKPILLKEGQEFNFSIKRGVSTEDTVSVNYDDFINDVEAGDILLVDGGMMSLAVKSKTSDIVKCEVIDGGELKSRRHL 245          
BLAST of CX293891 vs. ExPASy Swiss-Prot
Match: KPYG_RICCO (Pyruvate kinase isozyme G, chloroplastic (Fragment) OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.138e-43
Identity = 89/103 (86.41%), Postives = 95/103 (92.23%), Query Frame = 3
Query:  204 NSQFEDKAVAIMLDTKGPEVRSGDVPQPIILKEGQEFNFTIKRGVSTEDTVSVNYDDFVNDVEVGDILLVDGGMMSLAVKSKTKDLVKCIVVDGGELKSRRHL 512
            N+Q  D  V+IMLDTKGPEVRSGDVPQP+ LKEGQEFN TI+RGVST+DTVSVNYDDFVNDV VGDILLVDGGMMSLAVKSKT DLVKC+VVDGGELKSRRHL
Sbjct:    1 NAQSHDNVVSIMLDTKGPEVRSGDVPQPM-LKEGQEFNPTIRRGVSTQDTVSVNYDDFVNDVVVGDILLVDGGMMSLAVKSKTSDLVKCVVVDGGELKSRRHL 102          
BLAST of CX293891 vs. ExPASy Swiss-Prot
Match: KPYK_STAHJ (Pyruvate kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pyk PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 4.058e-33
Identity = 72/156 (46.15%), Postives = 107/156 (68.59%), Query Frame = 3
Query:   48 RKTKIVCTIGPSTSSREMIWKLAEEGMNVARLNMSHGDHASHQKTIDLVKEYNSQFEDKAVAIMLDTKGPEVRSGDVPQPII-LKEGQEFNFTIKRGVSTEDTVSVNYDDFVNDVEVGDILLVDGGMMSLAVK--SKTKDLVKCIVVDGGELKSRR 506
            RKTKIVCTIGP++ S EM+ KL + GMNVARLN SHG H  H+  ID +++   +   K + I+LDTKGPE+R+ D+   +I L++G+E   ++ +   T +  SV Y+D +NDV+VG  +L+D G++ L VK   KTK  VKC +++ GELK+++
Sbjct:    2 RKTKIVCTIGPASESEEMLEKLMKAGMNVARLNFSHGSHEEHKARIDTIRKVADRL-GKTIGILLDTKGPEIRTHDMKDGLIMLEKGKEVIVSMSQVEGTPEKFSVTYEDLINDVQVGSYILLDDGLVELQVKDIDKTKGEVKCDILNTGELKNKK 156          
BLAST of CX293891 vs. ExPASy Swiss-Prot
Match: KPYK_STAAW (Pyruvate kinase OS=Staphylococcus aureus (strain MW2) GN=pyk PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.486e-32
Identity = 73/156 (46.79%), Postives = 103/156 (66.03%), Query Frame = 3
Query:   48 RKTKIVCTIGPSTSSREMIWKLAEEGMNVARLNMSHGDHASHQKTIDLVKEYNSQFEDKAVAIMLDTKGPEVRSGDVPQPII-LKEGQEFNFTIKRGVSTEDTVSVNYDDFVNDVEVGDILLVDGGMMSLAVK--SKTKDLVKCIVVDGGELKSRR 506
            RKTKIVCTIGP++ S EMI KL   GMNVARLN SHG H  H+  ID +++   +  DK VAI+LDTKGPE+R+ ++   II L+ G E   ++     T +  SV Y++ +NDV+VG  +L+D G++ L VK     K  VKC +++ GELK+++
Sbjct:    2 RKTKIVCTIGPASESEEMIEKLINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRL-DKIVAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVEGTPEKFSVTYENLINDVQVGSYILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKK 156          
BLAST of CX293891 vs. ExPASy Swiss-Prot
Match: KPYK_STAAS (Pyruvate kinase OS=Staphylococcus aureus (strain MSSA476) GN=pyk PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.486e-32
Identity = 73/156 (46.79%), Postives = 103/156 (66.03%), Query Frame = 3
Query:   48 RKTKIVCTIGPSTSSREMIWKLAEEGMNVARLNMSHGDHASHQKTIDLVKEYNSQFEDKAVAIMLDTKGPEVRSGDVPQPII-LKEGQEFNFTIKRGVSTEDTVSVNYDDFVNDVEVGDILLVDGGMMSLAVK--SKTKDLVKCIVVDGGELKSRR 506
            RKTKIVCTIGP++ S EMI KL   GMNVARLN SHG H  H+  ID +++   +  DK VAI+LDTKGPE+R+ ++   II L+ G E   ++     T +  SV Y++ +NDV+VG  +L+D G++ L VK     K  VKC +++ GELK+++
Sbjct:    2 RKTKIVCTIGPASESEEMIEKLINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRL-DKIVAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVEGTPEKFSVTYENLINDVQVGSYILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKK 156          
BLAST of CX293891 vs. ExPASy Swiss-Prot
Match: KPYK_STAAR (Pyruvate kinase OS=Staphylococcus aureus (strain MRSA252) GN=pyk PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.486e-32
Identity = 73/156 (46.79%), Postives = 103/156 (66.03%), Query Frame = 3
Query:   48 RKTKIVCTIGPSTSSREMIWKLAEEGMNVARLNMSHGDHASHQKTIDLVKEYNSQFEDKAVAIMLDTKGPEVRSGDVPQPII-LKEGQEFNFTIKRGVSTEDTVSVNYDDFVNDVEVGDILLVDGGMMSLAVK--SKTKDLVKCIVVDGGELKSRR 506
            RKTKIVCTIGP++ S EMI KL   GMNVARLN SHG H  H+  ID +++   +  DK VAI+LDTKGPE+R+ ++   II L+ G E   ++     T +  SV Y++ +NDV+VG  +L+D G++ L VK     K  VKC +++ GELK+++
Sbjct:    2 RKTKIVCTIGPASESEEMIEKLINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRL-DKIVAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVEGTPEKFSVTYENLINDVQVGSYILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKK 156          
BLAST of CX293891 vs. ExPASy Swiss-Prot
Match: KPYK_STAAN (Pyruvate kinase OS=Staphylococcus aureus (strain N315) GN=pyk PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.486e-32
Identity = 73/156 (46.79%), Postives = 103/156 (66.03%), Query Frame = 3
Query:   48 RKTKIVCTIGPSTSSREMIWKLAEEGMNVARLNMSHGDHASHQKTIDLVKEYNSQFEDKAVAIMLDTKGPEVRSGDVPQPII-LKEGQEFNFTIKRGVSTEDTVSVNYDDFVNDVEVGDILLVDGGMMSLAVK--SKTKDLVKCIVVDGGELKSRR 506
            RKTKIVCTIGP++ S EMI KL   GMNVARLN SHG H  H+  ID +++   +  DK VAI+LDTKGPE+R+ ++   II L+ G E   ++     T +  SV Y++ +NDV+VG  +L+D G++ L VK     K  VKC +++ GELK+++
Sbjct:    2 RKTKIVCTIGPASESEEMIEKLINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRL-DKIVAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVEGTPEKFSVTYENLINDVQVGSYILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKK 156          
BLAST of CX293891 vs. ExPASy Swiss-Prot
Match: KPYK_STAAM (Pyruvate kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pyk PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.486e-32
Identity = 73/156 (46.79%), Postives = 103/156 (66.03%), Query Frame = 3
Query:   48 RKTKIVCTIGPSTSSREMIWKLAEEGMNVARLNMSHGDHASHQKTIDLVKEYNSQFEDKAVAIMLDTKGPEVRSGDVPQPII-LKEGQEFNFTIKRGVSTEDTVSVNYDDFVNDVEVGDILLVDGGMMSLAVK--SKTKDLVKCIVVDGGELKSRR 506
            RKTKIVCTIGP++ S EMI KL   GMNVARLN SHG H  H+  ID +++   +  DK VAI+LDTKGPE+R+ ++   II L+ G E   ++     T +  SV Y++ +NDV+VG  +L+D G++ L VK     K  VKC +++ GELK+++
Sbjct:    2 RKTKIVCTIGPASESEEMIEKLINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRL-DKIVAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVEGTPEKFSVTYENLINDVQVGSYILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKK 156          
BLAST of CX293891 vs. ExPASy Swiss-Prot
Match: KPYK_STAAC (Pyruvate kinase OS=Staphylococcus aureus (strain COL) GN=pyk PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.486e-32
Identity = 73/156 (46.79%), Postives = 103/156 (66.03%), Query Frame = 3
Query:   48 RKTKIVCTIGPSTSSREMIWKLAEEGMNVARLNMSHGDHASHQKTIDLVKEYNSQFEDKAVAIMLDTKGPEVRSGDVPQPII-LKEGQEFNFTIKRGVSTEDTVSVNYDDFVNDVEVGDILLVDGGMMSLAVK--SKTKDLVKCIVVDGGELKSRR 506
            RKTKIVCTIGP++ S EMI KL   GMNVARLN SHG H  H+  ID +++   +  DK VAI+LDTKGPE+R+ ++   II L+ G E   ++     T +  SV Y++ +NDV+VG  +L+D G++ L VK     K  VKC +++ GELK+++
Sbjct:    2 RKTKIVCTIGPASESEEMIEKLINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRL-DKIVAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVEGTPEKFSVTYENLINDVQVGSYILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKK 156          
BLAST of CX293891 vs. ExPASy Swiss-Prot
Match: KPYK_STAAB (Pyruvate kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pyk PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.486e-32
Identity = 73/156 (46.79%), Postives = 103/156 (66.03%), Query Frame = 3
Query:   48 RKTKIVCTIGPSTSSREMIWKLAEEGMNVARLNMSHGDHASHQKTIDLVKEYNSQFEDKAVAIMLDTKGPEVRSGDVPQPII-LKEGQEFNFTIKRGVSTEDTVSVNYDDFVNDVEVGDILLVDGGMMSLAVK--SKTKDLVKCIVVDGGELKSRR 506
            RKTKIVCTIGP++ S EMI KL   GMNVARLN SHG H  H+  ID +++   +  DK VAI+LDTKGPE+R+ ++   II L+ G E   ++     T +  SV Y++ +NDV+VG  +L+D G++ L VK     K  VKC +++ GELK+++
Sbjct:    2 RKTKIVCTIGPASESEEMIEKLINAGMNVARLNFSHGSHEEHKGRIDTIRKVAKRL-DKIVAILLDTKGPEIRTHNMKDGIIELERGNEVIVSMNEVEGTPEKFSVTYENLINDVQVGSYILLDDGLIELQVKDIDHAKKEVKCDILNSGELKNKK 156          
The following BLAST results are available for this feature:
BLAST of CX293891 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 93
Match NameE-valueIdentityDescription
KPYG_TOBAC2.428e-7886.67Pyruvate kinase isozyme G, chloroplastic OS=Nicoti... [more]
KPYG_RICCO1.138e-4386.41Pyruvate kinase isozyme G, chloroplastic (Fragment... [more]
KPYK_STAHJ4.058e-3346.15Pyruvate kinase OS=Staphylococcus haemolyticus (st... [more]
KPYK_STAAW4.486e-3246.79Pyruvate kinase OS=Staphylococcus aureus (strain M... [more]
KPYK_STAAS4.486e-3246.79Pyruvate kinase OS=Staphylococcus aureus (strain M... [more]
KPYK_STAAR4.486e-3246.79Pyruvate kinase OS=Staphylococcus aureus (strain M... [more]
KPYK_STAAN4.486e-3246.79Pyruvate kinase OS=Staphylococcus aureus (strain N... [more]
KPYK_STAAM4.486e-3246.79Pyruvate kinase OS=Staphylococcus aureus (strain M... [more]
KPYK_STAAC4.486e-3246.79Pyruvate kinase OS=Staphylococcus aureus (strain C... [more]
KPYK_STAAB4.486e-3246.79Pyruvate kinase OS=Staphylococcus aureus (strain b... [more]

Pages

back to top
Libraries
Library NameType
FlavRip1cdna_library
Properties
Property NameValue
Genbank descriptionC05002B09SK FlavRip1 Citrus clementina cDNA clone C05002B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293891 ID=CX293891|Name=CX293891|organism=Citrus clementina|type=EST|length=513bp
ATGGTCAGTGCACACCTGGAAAGGGAGTTGTAGGTCCAAATGCTAGAAGA
AAAACGAAGATAGTGTGTACAATTGGTCCTTCCACAAGCTCACGGGAAAT
GATATGGAAACTGGCAGAAGAGGGAATGAATGTGGCACGTTTAAATATGT
CGCATGGAGACCATGCATCACACCAGAAAACTATTGATCTCGTCAAAGAA
TACAATTCTCAATTTGAAGACAAGGCTGTAGCCATAATGCTGGACACCAA
GGGTCCTGAGGTTAGGAGTGGAGATGTACCTCAACCAATCATCCTGAAGG
AGGGTCAGGAATTTAATTTTACTATCAAAAGAGGGGTTAGCACAGAAGAT
ACTGTTAGTGTGAACTATGATGACTTTGTGAATGACGTAGAGGTTGGAGA
CATACTACTGGTAGATGGTGGAATGATGTCATTAGCTGTGAAGTCAAAGA
CAAAGGATCTGGTTAAATGCATAGTAGTTGATGGCGGTGAGCTAAAATCA
AGACGTCATTTAA
back to top