CX293894

Overview
NameCX293894
Unique NameCX293894
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length548
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig801 contig Ccv1_Contig801:191..738. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX293894 vs. ExPASy Swiss-Prot
Match: G6PDC_TOBAC (Glucose-6-phosphate 1-dehydrogenase, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 5.817e-39
Identity = 76/92 (82.61%), Postives = 81/92 (88.04%), Query Frame = 1
Query:   10 RLDRSHLNLHYAARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPXXXXXXXXXIIPEYYPYGSRGPVGAHYLAARYNVRWGDL 285
            RLDRS+LNL Y+ARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAW+LFTP         I+PEYYPYGSRGP+GAHYLAARY VRWGDL
Sbjct:  501 RLDRSNLNLLYSARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAWSLFTPVLKELEDKKIVPEYYPYGSRGPIGAHYLAARYKVRWGDL 592          
BLAST of CX293894 vs. ExPASy Swiss-Prot
Match: G6PD2_ARATH (Glucose-6-phosphate 1-dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=At5g13110 PE=2 SV=2)

HSP 1 Score: 156.377 bits (394), Expect = 8.400e-38
Identity = 74/96 (77.08%), Postives = 83/96 (86.46%), Query Frame = 1
Query:   10 RLDRSHLNLHYAARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPXXXXXXXXXIIPEYYPYGSRGPVGAHYLAARYNVRWGDLGVEQ 297
            RLDRS+LNL Y+ARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAW+LFTP          IPEYYPYGSRGPVGAHYLAA++ V+WGD+ ++Q
Sbjct:  501 RLDRSNLNLLYSARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAWSLFTPLLKEIEEKKRIPEYYPYGSRGPVGAHYLAAKHKVQWGDVSIDQ 596          
BLAST of CX293894 vs. ExPASy Swiss-Prot
Match: G6PD3_ARATH (Glucose-6-phosphate 1-dehydrogenase 3, chloroplastic OS=Arabidopsis thaliana GN=At1g24280 PE=2 SV=2)

HSP 1 Score: 153.68 bits (387), Expect = 5.444e-37
Identity = 73/96 (76.04%), Postives = 82/96 (85.42%), Query Frame = 1
Query:   10 RLDRSHLNLHYAARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPXXXXXXXXXIIPEYYPYGSRGPVGAHYLAARYNVRWGDLGVEQ 297
            RLD+S+LNL Y+ARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTP           PE+YPYGSRGPVGAHYLAA++ V+WGDL ++Q
Sbjct:  504 RLDQSNLNLLYSARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPLLKEIEEKKTTPEFYPYGSRGPVGAHYLAAKHKVQWGDLSLDQ 599          
BLAST of CX293894 vs. ExPASy Swiss-Prot
Match: G6PD1_ARATH (Glucose-6-phosphate 1-dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=APG1 PE=2 SV=2)

HSP 1 Score: 153.295 bits (386), Expect = 7.111e-37
Identity = 74/93 (79.57%), Postives = 78/93 (83.87%), Query Frame = 1
Query:   10 RLDRSHLNLHYAARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPXXXXXXXXXIIPEYYPYGSRGPVGAHYLAARYNVRWGDLG 288
            RLDRS LNL Y +RY +EIPDAYERLLLDAIEGERRLFIRSDELDAAW LFTP         IIPE YPYGSRGPVGAHYLA++YNVRWGDLG
Sbjct:  482 RLDRSDLNLLYRSRYPREIPDAYERLLLDAIEGERRLFIRSDELDAAWDLFTPALKELEEKKIIPELYPYGSRGPVGAHYLASKYNVRWGDLG 574          
BLAST of CX293894 vs. ExPASy Swiss-Prot
Match: G6PDC_SOLTU (Glucose-6-phosphate 1-dehydrogenase, chloroplastic OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.341e-35
Identity = 73/92 (79.35%), Postives = 76/92 (82.61%), Query Frame = 1
Query:   10 RLDRSHLNLHYAARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPXXXXXXXXXIIPEYYPYGSRGPVGAHYLAARYNVRWGDL 285
            RLDRS LNL Y A+Y  EIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTP         I PE YPYGSRGPVGAHYLAA++NVRWGDL
Sbjct:  482 RLDRSDLNLLYKAKYRGEIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPLLKELEEKKIAPELYPYGSRGPVGAHYLAAKHNVRWGDL 573          
BLAST of CX293894 vs. ExPASy Swiss-Prot
Match: G6PDC_SPIOL (Glucose-6-phosphate 1-dehydrogenase, chloroplastic OS=Spinacia oleracea GN=G6PD PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.135e-34
Identity = 70/95 (73.68%), Postives = 77/95 (81.05%), Query Frame = 1
Query:   10 RLDRSHLNLHYAARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPXXXXXXXXXIIPEYYPYGSRGPVGAHYLAARYNVRWGDLGVE 294
            RLDR+ LNL Y+ RY  EIPDAYERLLLDAIEGERRLFIRSD+LDAAW+LFTP         + PE YPYGSRGPVGAHYLAA++NVRWGDL  E
Sbjct:  478 RLDRTDLNLCYSTRYRGEIPDAYERLLLDAIEGERRLFIRSDKLDAAWSLFTPLLKELEEKKVAPELYPYGSRGPVGAHYLAAKHNVRWGDLSGE 572          
BLAST of CX293894 vs. ExPASy Swiss-Prot
Match: G6PD4_ARATH (Glucose-6-phosphate 1-dehydrogenase 4, chloroplastic OS=Arabidopsis thaliana GN=At1g09420 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 5.120e-19
Identity = 43/91 (47.25%), Postives = 57/91 (62.64%), Query Frame = 1
Query:   10 RLDRSHLNLHYAARYSKEIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPXXXXXXXXXIIPEYYPYGSRGPVGAHYLAARYNVRWGD 282
            +LD S LNL Y  RY  E+PD+YE L+ D I+G+  LF+RSDE+ AAW + +P           PE Y +G RGPV A+YL A++ V W D
Sbjct:  534 QLDASELNLLYKDRYKTEVPDSYEHLIHDVIDGDNHLFMRSDEVAAAWNILSPVLEEIDKHHTAPELYEFGGRGPVAAYYLWAKHGVPWAD 624          
BLAST of CX293894 vs. ExPASy Swiss-Prot
Match: G6PD_DICDI (Glucose-6-phosphate 1-dehydrogenase OS=Dictyostelium discoideum GN=g6pd-1 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.180e-15
Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1
Query:   10 RLDRSHLNLHYAARYSK-EIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPXXXXXXXXXIIPEYYPYGSRGPVGAHYLAARY 264
            +++++ L+L Y  R+   ++PDAYERL+LD+I+G+  LF+R DELD AW +FTP         I PE Y +GSRGP  A  L+ ++
Sbjct:  392 KIEQTELDLSYRHRFENLDLPDAYERLILDSIKGDHNLFVRDDELDVAWQIFTPLLDQIEKEKIKPEPYSFGSRGPKSADELSKKF 477          
BLAST of CX293894 vs. ExPASy Swiss-Prot
Match: G6PD_EMENI (Glucose-6-phosphate 1-dehydrogenase OS=Emericella nidulans GN=gsdA PE=3 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 1.443e-13
Identity = 40/89 (44.94%), Postives = 54/89 (60.67%), Query Frame = 1
Query:   22 SHLNLHYAARYSK-EIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTP-XXXXXXXXXIIPEYYPYGSRGPVGAHYLAARYNVRWGD 282
            + L+L Y  R+S  +IP+AYE L+LDA++G+   F+R DELDA+W +FTP          IIP  YPYGSRGP       A Y  ++ D
Sbjct:  407 TELDLTYRRRFSDLKIPEAYESLILDALKGDHSNFVRDDELDASWRMFTPLLHYLDDNKEIIPMEYPYGSRGPSVLDDFTASYGYKFSD 495          
BLAST of CX293894 vs. ExPASy Swiss-Prot
Match: G6PD_ASPNG (Glucose-6-phosphate 1-dehydrogenase OS=Aspergillus niger GN=gsdA PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.461e-13
Identity = 39/89 (43.82%), Postives = 54/89 (60.67%), Query Frame = 1
Query:   22 SHLNLHYAARYSK-EIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTP-XXXXXXXXXIIPEYYPYGSRGPVGAHYLAARYNVRWGD 282
            + L+L Y  R+S  +IP+AYE L+LDA++G+   F+R DELDA+W +FTP          IIP  YPYGSRGP       A +  ++ D
Sbjct:  407 TELDLTYRRRFSDLKIPEAYESLILDALKGDHSNFVRDDELDASWRIFTPLLHYLDDNKEIIPMEYPYGSRGPAVLDDFTASFGYKFSD 495          
The following BLAST results are available for this feature:
BLAST of CX293894 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
G6PDC_TOBAC5.817e-3982.61Glucose-6-phosphate 1-dehydrogenase, chloroplastic... [more]
G6PD2_ARATH8.400e-3877.08Glucose-6-phosphate 1-dehydrogenase 2, chloroplast... [more]
G6PD3_ARATH5.444e-3776.04Glucose-6-phosphate 1-dehydrogenase 3, chloroplast... [more]
G6PD1_ARATH7.111e-3779.57Glucose-6-phosphate 1-dehydrogenase 1, chloroplast... [more]
G6PDC_SOLTU1.341e-3579.35Glucose-6-phosphate 1-dehydrogenase, chloroplastic... [more]
G6PDC_SPIOL1.135e-3473.68Glucose-6-phosphate 1-dehydrogenase, chloroplastic... [more]
G6PD4_ARATH5.120e-1947.25Glucose-6-phosphate 1-dehydrogenase 4, chloroplast... [more]
G6PD_DICDI1.180e-1544.19Glucose-6-phosphate 1-dehydrogenase OS=Dictyosteli... [more]
G6PD_EMENI1.443e-1344.94Glucose-6-phosphate 1-dehydrogenase OS=Emericella ... [more]
G6PD_ASPNG2.461e-1343.82Glucose-6-phosphate 1-dehydrogenase OS=Aspergillus... [more]

Pages

back to top
Libraries
Library NameType
FlavRip1cdna_library
Properties
Property NameValue
Genbank descriptionC05002C01SK FlavRip1 Citrus clementina cDNA clone C05002C01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293894 ID=CX293894|Name=CX293894|organism=Citrus clementina|type=EST|length=548bp
GCACGAGGGAGATTAGACCGTAGCCATCTAAACCTTCACTATGCAGCAAG
ATACTCAAAGGAGATTCCAGATGCATATGAGAGGCTTCTGCTGGATGCTA
TAGAAGGGGAAAGAAGACTATTTATCCGAAGTGATGAACTAGATGCTGCA
TGGGCGCTCTTCACTCCTCTTTTGAAGGAACTAGAAGAGAAAAAGATCAT
CCCTGAATACTATCCTTACGGAAGTCGTGGCCCTGTTGGGGCTCACTACC
TTGCCGCCAGATACAATGTCCGATGGGGTGACCTCGGTGTAGAGCAATAA
CTGCTATCAGTGATATTAGAAGAGCTAAAAGCTTATATTTATCATCCTAA
TTATTAGGCTGCATTAAGTTTGTATTTTGCCATATCGATAGATGAAGATA
GCACATTAAGTTTATGATCTTGTGAGATTTATTCTTTGCATTAAAAATCT
GCTTCTGTAATATTTTCTTCGTCCTACCATCTTTCCTGTTCCTTTTCTTC
TATCTTTTTGGGTCCAAAGTTTTAAGAGCAAATAGATTGAGTTTCTTA
back to top