CX293896

Overview
NameCX293896
Unique NameCX293896
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length526
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig445 contig Ccv1_Contig445:80..605. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX293896 vs. ExPASy Swiss-Prot
Match: CALM_LILLO (Calmodulin OS=Lilium longiflorum PE=2 SV=2)

HSP 1 Score: 291.582 bits (745), Expect = 1.540e-78
Identity = 145/149 (97.32%), Postives = 146/149 (97.99%), Query Frame = 2
Query:    8 MADQLTDDQISEFKEAFTLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEADADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDTDQNGFISTAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 454
            MADQLTDDQISEFKEAF+LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINE DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFD DQNGFIS AELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CX293896 vs. ExPASy Swiss-Prot
Match: CALM_EUPCH (Calmodulin OS=Euphorbia characias PE=2 SV=4)

HSP 1 Score: 291.582 bits (745), Expect = 1.540e-78
Identity = 145/149 (97.32%), Postives = 146/149 (97.99%), Query Frame = 2
Query:    8 MADQLTDDQISEFKEAFTLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEADADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDTDQNGFISTAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 454
            MADQLTDDQISEFKEAF+LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINE DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFD DQNGFIS AELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CX293896 vs. ExPASy Swiss-Prot
Match: CALM_BRYDI (Calmodulin OS=Bryonia dioica PE=2 SV=2)

HSP 1 Score: 291.582 bits (745), Expect = 1.540e-78
Identity = 145/149 (97.32%), Postives = 146/149 (97.99%), Query Frame = 2
Query:    8 MADQLTDDQISEFKEAFTLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEADADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDTDQNGFISTAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 454
            MADQLTDDQISEFKEAF+LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINE DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFD DQNGFIS AELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CX293896 vs. ExPASy Swiss-Prot
Match: CALM7_ARATH (Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2)

HSP 1 Score: 291.582 bits (745), Expect = 1.540e-78
Identity = 145/149 (97.32%), Postives = 146/149 (97.99%), Query Frame = 2
Query:    8 MADQLTDDQISEFKEAFTLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEADADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDTDQNGFISTAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 454
            MADQLTDDQISEFKEAF+LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINE DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFD DQNGFIS AELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CX293896 vs. ExPASy Swiss-Prot
Match: CALM1_PETHY (Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=2 SV=2)

HSP 1 Score: 291.582 bits (745), Expect = 1.540e-78
Identity = 145/149 (97.32%), Postives = 146/149 (97.99%), Query Frame = 2
Query:    8 MADQLTDDQISEFKEAFTLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEADADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDTDQNGFISTAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 454
            MADQLTDDQISEFKEAF+LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINE DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFD DQNGFIS AELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CX293896 vs. ExPASy Swiss-Prot
Match: CALM1_DAUCA (Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 SV=2)

HSP 1 Score: 291.582 bits (745), Expect = 1.540e-78
Identity = 145/149 (97.32%), Postives = 146/149 (97.99%), Query Frame = 2
Query:    8 MADQLTDDQISEFKEAFTLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEADADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDTDQNGFISTAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 454
            MADQLTDDQISEFKEAF+LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINE DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFD DQNGFIS AELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CX293896 vs. ExPASy Swiss-Prot
Match: CALM_HORVU (Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2)

HSP 1 Score: 290.426 bits (742), Expect = 3.431e-78
Identity = 144/149 (96.64%), Postives = 146/149 (97.99%), Query Frame = 2
Query:    8 MADQLTDDQISEFKEAFTLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEADADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDTDQNGFISTAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 454
            MADQLTDDQI+EFKEAF+LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINE DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFD DQNGFIS AELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CX293896 vs. ExPASy Swiss-Prot
Match: CALM_CAPAN (Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3)

HSP 1 Score: 290.426 bits (742), Expect = 3.431e-78
Identity = 144/149 (96.64%), Postives = 146/149 (97.99%), Query Frame = 2
Query:    8 MADQLTDDQISEFKEAFTLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEADADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDTDQNGFISTAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 454
            MADQLTDDQISEFKEAF+LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINE DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFD DQNGFIS AELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINY+EFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYDEFVKVMMAK 149          
BLAST of CX293896 vs. ExPASy Swiss-Prot
Match: CALM2_SOYBN (Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2)

HSP 1 Score: 290.426 bits (742), Expect = 3.431e-78
Identity = 144/149 (96.64%), Postives = 146/149 (97.99%), Query Frame = 2
Query:    8 MADQLTDDQISEFKEAFTLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEADADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDTDQNGFISTAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 454
            MADQLTDDQI+EFKEAF+LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINE DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFD DQNGFIS AELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CX293896 vs. ExPASy Swiss-Prot
Match: CALM2_ARATH (Calmodulin-2/3/5 OS=Arabidopsis thaliana GN=CAM2 PE=1 SV=3)

HSP 1 Score: 290.426 bits (742), Expect = 3.431e-78
Identity = 144/149 (96.64%), Postives = 146/149 (97.99%), Query Frame = 2
Query:    8 MADQLTDDQISEFKEAFTLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEADADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDTDQNGFISTAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 454
            MADQLTDDQISEFKEAF+LFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINE DADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFD DQNGFIS AELRHVMTNLGEKLTDEEVDEMI+EADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDGQINYEEFVKVMMAK 149          
The following BLAST results are available for this feature:
BLAST of CX293896 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 476
Match NameE-valueIdentityDescription
CALM_LILLO1.540e-7897.32Calmodulin OS=Lilium longiflorum PE=2 SV=2[more]
CALM_EUPCH1.540e-7897.32Calmodulin OS=Euphorbia characias PE=2 SV=4[more]
CALM_BRYDI1.540e-7897.32Calmodulin OS=Bryonia dioica PE=2 SV=2[more]
CALM7_ARATH1.540e-7897.32Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 ... [more]
CALM1_PETHY1.540e-7897.32Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=2 SV=2[more]
CALM1_DAUCA1.540e-7897.32Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 ... [more]
CALM_HORVU3.431e-7896.64Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2[more]
CALM_CAPAN3.431e-7896.64Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3[more]
CALM2_SOYBN3.431e-7896.64Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2[more]
CALM2_ARATH3.431e-7896.64Calmodulin-2/3/5 OS=Arabidopsis thaliana GN=CAM2 P... [more]

Pages

back to top
Libraries
Library NameType
FlavRip1cdna_library
Properties
Property NameValue
Genbank descriptionC05002C04SK FlavRip1 Citrus clementina cDNA clone C05002C04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293896 ID=CX293896|Name=CX293896|organism=Citrus clementina|type=EST|length=526bp
AAGAAAAATGGCGGATCAGCTCACGGACGATCAGATCTCTGAGTTCAAAG
AGGCCTTCACCTTGTTTGACAAGGATGGCGACGGTTGCATTACCACCAAG
GAGCTTGGCACTGTTATGAGGTCACTGGGTCAGAACCCCACTGAGGCTGA
GCTCCAGGACATGATCAATGAAGCGGATGCTGATGGTAATGGAACTATTG
ATTTTCCTGAATTCCTAAACCTCATGGCCAGGAAGATGAAGGATACCGAC
TCTGAGGAGGAGCTGAAAGAGGCCTTCCGGGTTTTCGACACGGATCAGAA
TGGTTTCATCTCAACTGCTGAGCTGCGCCATGTGATGACAAACCTAGGAG
AGAAACTTACTGATGAAGAAGTTGATGAGATGATAAGGGAAGCTGATGTT
GATGGTGATGGCCAGATAAATTATGAGGAATTTGTCAAGGTTATGATGGC
CAAGTAATGACCCCAACCCACCAATACTTATAAAATGGGTTGACTAAATT
ATAAAGGGATTCCTAGTTTTCTCTTT
back to top