CX293983

Overview
NameCX293983
Unique NameCX293983
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length518
Libraries
Library NameType
FlavRip1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10443 contig Ccv1_Contig10443:14..531. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX293983 vs. ExPASy Swiss-Prot
Match: GSTU6_ORYSJ (Probable glutathione S-transferase GSTU6 OS=Oryza sativa subsp. japonica GN=GSTU6 PE=2 SV=2)

HSP 1 Score: 190.66 bits (483), Expect = 3.531e-48
Identity = 89/165 (53.94%), Postives = 121/165 (73.33%), Query Frame = 2
Query:   32 DVKVLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAW---SSSGPSILPSDPYDRAVARFWAAYVDEKLFPA-LKSIGSAHGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIAFG 514
            ++K+LG W SP+ +R R+ L +KS+ YE++EENLG KS+LLL SNPVHK +PVL+H  +PV ES +IV+Y+DE W   +   PS++PSDPY+RAVARFWAAYVD+K+ PA L  +  +   E + AA+ Q +  L  LE AF +CSKGKPFFGG  +GF+D+  G
Sbjct:    6 ELKLLGVWSSPYAIRVRVVLNLKSLPYEYVEENLGDKSDLLLASNPVHKSVPVLLHAGRPVNESQVIVQYIDEVWPGGAGGRPSVMPSDPYERAVARFWAAYVDDKVRPAWLAILFGSKTEEERAAAVAQAVAALETLEGAFGECSKGKPFFGGDGVGFVDVVLG 170          
BLAST of CX293983 vs. ExPASy Swiss-Prot
Match: GSTX4_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.535e-43
Identity = 88/163 (53.99%), Postives = 114/163 (69.94%), Query Frame = 2
Query:   20 MAKSDVKVLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSAHGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIA 508
            MA  +V +L  WPS F MR RIAL  K ++YE+ EE+L +KS LLL+ NP+HKKIPVLIHN KP+CES+I VEY++E W    P++LPSDPYDRA ARFWA Y+D+KL+   + + +  G E +EAA +  IE L +LE A       KP+FGG   GF+DIA
Sbjct:    1 MANEEVILLDFWPSMFGMRLRIALAEKEIKYEYKEEDLRNKSPLLLQMNPIHKKIPVLIHNGKPICESIIAVEYIEEVWKDKAPNLLPSDPYDRAQARFWADYIDKKLYDFGRKLWTTKG-EEQEAAKKDFIECLKVLEGAL----GDKPYFGGESFGFVDIA 158          
BLAST of CX293983 vs. ExPASy Swiss-Prot
Match: GSTXC_TOBAC (Probable glutathione S-transferase parC OS=Nicotiana tabacum GN=PARC PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 3.420e-43
Identity = 87/163 (53.37%), Postives = 114/163 (69.94%), Query Frame = 2
Query:   20 MAKSDVKVLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSAHGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIA 508
            MA  +V +L  WPS F MR RIAL  K ++YE+ +E+L +KS LLL+ NP+HKKIPVLIHN KP+CES+I VEY++E W    PS+LPSDPYDRA ARFWA Y+D+KL+   + + +  G E +EAA +  IE L +LE A       +P+FGG   GF+DIA
Sbjct:    1 MANEEVILLDFWPSMFGMRLRIALAEKEIKYEYKQEDLRNKSPLLLQMNPIHKKIPVLIHNGKPICESIIAVEYIEEVWKDKAPSLLPSDPYDRAQARFWADYIDKKLYDFGRKLWATKG-EEQEAAKKDFIECLKVLEGAL----GDRPYFGGESFGFVDIA 158          
BLAST of CX293983 vs. ExPASy Swiss-Prot
Match: GSTX6_SOYBN (Probable glutathione S-transferase OS=Glycine max GN=HSP26-A PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 2.217e-42
Identity = 84/161 (52.17%), Postives = 114/161 (70.81%), Query Frame = 2
Query:   26 KSDVKVLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSAHGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIA 508
            + DVK+LG   SPFV R +IALK+K VEY+FLEENLG+KS+LLLK NPVHKK+PV +HN++P+ ESL+IVEY+DE W ++   ILPSDPY RA+ARFW+ ++D+K+  A+         + +E  +E+  E L  LE+      K K FFGG + G +DIA
Sbjct:    5 QEDVKLLGIVGSPFVCRVQIALKLKGVEYKFLEENLGNKSDLLLKYNPVHKKVPVFVHNEQPIAESLVIVEYIDETWKNN--PILPSDPYQRALARFWSKFIDDKIVGAVSKSVFTVDEKEREKNVEETYEALQFLENEL----KDKKFFGGEEFGLVDIA 159          
BLAST of CX293983 vs. ExPASy Swiss-Prot
Match: GSTXA_TOBAC (Probable glutathione S-transferase parA OS=Nicotiana tabacum GN=PARA PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.139e-38
Identity = 82/163 (50.31%), Postives = 109/163 (66.87%), Query Frame = 2
Query:   20 MAKSDVKVLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSAHGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIA 508
            M  ++V +L  WPS F MR RIAL +K ++YE  EENL  KS LLL+ NPVHKKIP+LIHN K +CESL I+EY+DE W    P +LPSDPY+R+ ARFWA Y+D+K++   + + S  G E +E A ++ IE L  LE         K +FGG  +GF+D+A
Sbjct:    1 MESNNVVLLDFWPSSFGMRLRIALALKGIKYEAKEENLSDKSPLLLEMNPVHKKIPILIHNSKAICESLNILEYIDEVWHDKCP-LLPSDPYERSQARFWADYIDKKIYSTGRRVWSGKG-EDQEEAKKEFIEILKTLEGEL----GNKTYFGGDNLGFVDVA 157          
BLAST of CX293983 vs. ExPASy Swiss-Prot
Match: GSTX1_SOLTU (Probable glutathione S-transferase OS=Solanum tuberosum GN=PRP1 PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 3.313e-38
Identity = 87/159 (54.72%), Postives = 111/159 (69.81%), Query Frame = 2
Query:   29 SDVKVLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSAHGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDI 505
            ++VK+LG   SPF  R   ALKIK V+YEF+EE+L +KS LLL+SNP+HKKIPVLIHN K +CES++I+EY+DEA+   GPSILP DPYDRA+ARFWA YV++K     KS  S    E +E A E+  E L +L++ F    K K  F G + GF DI
Sbjct:    2 AEVKLLGLRYSPFSHRVEWALKIKGVKYEFIEEDLQNKSPLLLQSNPIHKKIPVLIHNGKCICESMVILEYIDEAF--EGPSILPKDPYDRALARFWAKYVEDKGAAVWKSFFSK--GEEQEKAKEEAYEMLKILDNEF----KDKKCFVGDKFGFADI 152          
BLAST of CX293983 vs. ExPASy Swiss-Prot
Match: GSTX2_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 9.639e-38
Identity = 81/160 (50.62%), Postives = 111/160 (69.38%), Query Frame = 2
Query:   29 SDVKVLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSAHGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIA 508
            ++VK+LG W SPF  R   ALKIK V+YE++EE+  +KS LLL+SNPV+KK+PVLIHN KP+ ES+II+EY+DE +   GPSILP DPYDRA+ARFWA ++D+K+   + +       E +E   E++ E L +L++      K K FF G + GF DIA
Sbjct:    2 AEVKLLGFWYSPFSHRVEWALKIKGVKYEYIEEDRDNKSSLLLQSNPVYKKVPVLIHNGKPIVESMIILEYIDETF--EGPSILPKDPYDRALARFWAKFLDDKVAAVVNTF--FRKGEEQEKGKEEVYEMLKVLDNEL----KDKKFFAGDKFGFADIA 153          
BLAST of CX293983 vs. ExPASy Swiss-Prot
Match: GSTX1_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 3.663e-37
Identity = 80/160 (50.00%), Postives = 111/160 (69.38%), Query Frame = 2
Query:   29 SDVKVLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSAHGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIA 508
            ++VK+LG W SPF  R   ALKIK V+YE++EE+  +KS LLL+SNP+HKK+PVLIHN K + ES++I+EY+DE +   GPSILP DPYDRA+ARFWA ++D+K+   +K+       E +E   E++ E L +L++      K K FF G + GF DIA
Sbjct:    2 AEVKLLGFWYSPFSRRVEWALKIKGVKYEYIEEDRDNKSSLLLQSNPIHKKVPVLIHNGKRIVESMVILEYIDETF--EGPSILPKDPYDRALARFWAKFLDDKVPAVVKTF--LRKGEEQEKDKEEVCEMLKVLDNEL----KDKKFFVGDKFGFADIA 153          
BLAST of CX293983 vs. ExPASy Swiss-Prot
Match: GSTX3_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 8.160e-37
Identity = 78/160 (48.75%), Postives = 110/160 (68.75%), Query Frame = 2
Query:   29 SDVKVLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSAHGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDIA 508
            ++VK+LG W SPF  R   ALK+K V+YE++EE+  +KS LLL+SNPVHKK+PVLIHN KP+ ES++I+EY+DE +   GPSILP DPYDRA+ARFW+ ++ +K+   + +       E +E   E++ E L +L++      K K FF G + GF DIA
Sbjct:    2 AEVKLLGFWYSPFTHRVEWALKLKGVKYEYIEEDRDNKSSLLLQSNPVHKKVPVLIHNGKPIVESMVILEYIDETF--EGPSILPKDPYDRALARFWSKFLGDKVAAVVNTF--FRKGEEQEKGKEEVYEMLKVLDNEL----KDKKFFVGDKFGFADIA 153          
BLAST of CX293983 vs. ExPASy Swiss-Prot
Match: GSTX3_SOYBN (Glutathione S-transferase 3 OS=Glycine max GN=GST3 PE=1 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 2.374e-36
Identity = 76/158 (48.10%), Postives = 104/158 (65.82%), Query Frame = 2
Query:   32 DVKVLGAWPSPFVMRARIALKIKSVEYEFLEENLGSKSELLLKSNPVHKKIPVLIHNDKPVCESLIIVEYVDEAWSSSGPSILPSDPYDRAVARFWAAYVDEKLFPALKSIGSAHGAEAKEAAIEQLIEGLVLLEDAFVKCSKGKPFFGGSQIGFLDI 505
            +V +L  W S + MRARIAL  K V YE+ EENL ++S LLL+ NP+HKKIPVLIHN KP+CES IIV+Y+DE W+   P ++PSDPY R+ ARFW  Y+D+K++   K +  + G E +E   ++LI     LE+        KPF+G    GF+D+
Sbjct:    4 EVVLLDTWASMYGMRARIALAEKGVRYEYKEENLMNRSPLLLQMNPIHKKIPVLIHNGKPICESAIIVQYIDEVWNDKSP-LMPSDPYKRSQARFWVDYIDKKIYDTWKKMWLSKGEEHEEGK-KELISIFKQLEETLT----DKPFYGDDTFGFVDL 155          
The following BLAST results are available for this feature:
BLAST of CX293983 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
GSTU6_ORYSJ3.531e-4853.94Probable glutathione S-transferase GSTU6 OS=Oryza ... [more]
GSTX4_TOBAC1.535e-4353.99Probable glutathione S-transferase OS=Nicotiana ta... [more]
GSTXC_TOBAC3.420e-4353.37Probable glutathione S-transferase parC OS=Nicotia... [more]
GSTX6_SOYBN2.217e-4252.17Probable glutathione S-transferase OS=Glycine max ... [more]
GSTXA_TOBAC1.139e-3850.31Probable glutathione S-transferase parA OS=Nicotia... [more]
GSTX1_SOLTU3.313e-3854.72Probable glutathione S-transferase OS=Solanum tube... [more]
GSTX2_TOBAC9.639e-3850.63Probable glutathione S-transferase OS=Nicotiana ta... [more]
GSTX1_TOBAC3.663e-3750.00Probable glutathione S-transferase OS=Nicotiana ta... [more]
GSTX3_TOBAC8.160e-3748.75Probable glutathione S-transferase OS=Nicotiana ta... [more]
GSTX3_SOYBN2.374e-3648.10Glutathione S-transferase 3 OS=Glycine max GN=GST3... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05004D07SK FlavRip1 Citrus clementina cDNA clone C05004D07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293983 ID=CX293983|Name=CX293983|organism=Citrus clementina|type=EST|length=518bp
CTCGTGCCGAACAAAGAAAATGGCAAAAAGCGACGTGAAGGTTTTGGGTG
CGTGGCCAAGCCCATTTGTGATGAGGGCAAGAATCGCACTTAAGATCAAG
TCTGTGGAGTATGAGTTTCTGGAGGAGAATTTGGGATCCAAAAGCGAGCT
TCTGCTTAAATCAAACCCTGTTCACAAGAAAATCCCAGTTCTGATTCACA
ATGATAAGCCTGTTTGCGAATCTCTCATCATTGTCGAGTACGTGGATGAG
GCTTGGTCCTCTTCAGGTCCCTCTATTCTTCCTTCTGATCCTTATGACCG
TGCCGTTGCTCGTTTCTGGGCCGCTTATGTTGATGAGAAGTTGTTCCCTG
CCTTGAAAAGCATTGGTAGTGCACATGGAGCGGAAGCTAAGGAAGCTGCG
ATTGAGCAATTGATTGAAGGCTTGGTTTTGCTGGAGGATGCTTTTGTTAA
GTGTAGCAAAGGGAAGCCTTTCTTTGGTGGAAGCCAAATTGGGTTTCTTG
ACATTGCATTTGGTTGCT
back to top