CX293994

Overview
NameCX293994
Unique NameCX293994
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length308
Libraries
Library NameType
FlavRip1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig560 contig Ccv1_Contig560:165..472. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX293994 vs. ExPASy Swiss-Prot
Match: YBEB_SHIFL (Uncharacterized protein ybeB OS=Shigella flexneri GN=ybeB PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.818e-12
Identity = 36/100 (36.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:    3 LTDVRADDVKVIPVGEKCDWTDYMVIATGRSTWHVKNIAQAIIYKAKQRQREVGAKQMMLP-SVQGQDTGKWVIIDSGKVIVHALDENARAYYNLEDLWT 299
            + D++  D+  + V  K   TD M+I TG S+ HV +IA  ++    Q  R  G    +LP  V+G+++  W+++D G VIVH + E +R  Y LE LW+
Sbjct:   14 IDDLKGQDIIALDVQGKSSITDCMIICTGTSSRHVMSIADHVV----QESRAAG----LLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLWS 105          
BLAST of CX293994 vs. ExPASy Swiss-Prot
Match: YBEB_ECOLI (Uncharacterized protein ybeB OS=Escherichia coli (strain K12) GN=ybeB PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.818e-12
Identity = 36/100 (36.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:    3 LTDVRADDVKVIPVGEKCDWTDYMVIATGRSTWHVKNIAQAIIYKAKQRQREVGAKQMMLP-SVQGQDTGKWVIIDSGKVIVHALDENARAYYNLEDLWT 299
            + D++  D+  + V  K   TD M+I TG S+ HV +IA  ++    Q  R  G    +LP  V+G+++  W+++D G VIVH + E +R  Y LE LW+
Sbjct:   14 IDDLKGQDIIALDVQGKSSITDCMIICTGTSSRHVMSIADHVV----QESRAAG----LLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLWS 105          
BLAST of CX293994 vs. ExPASy Swiss-Prot
Match: YBEB_ECOL6 (Uncharacterized protein ybeB OS=Escherichia coli O6 GN=ybeB PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.818e-12
Identity = 36/100 (36.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query:    3 LTDVRADDVKVIPVGEKCDWTDYMVIATGRSTWHVKNIAQAIIYKAKQRQREVGAKQMMLP-SVQGQDTGKWVIIDSGKVIVHALDENARAYYNLEDLWT 299
            + D++  D+  + V  K   TD M+I TG S+ HV +IA  ++    Q  R  G    +LP  V+G+++  W+++D G VIVH + E +R  Y LE LW+
Sbjct:   14 IDDLKGQDIIALDVQGKSSITDCMIICTGTSSRHVMSIADHVV----QESRAAG----LLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLWS 105          
The following BLAST results are available for this feature:
BLAST of CX293994 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
YBEB_SHIFL8.818e-1236.00Uncharacterized protein ybeB OS=Shigella flexneri ... [more]
YBEB_ECOLI8.818e-1236.00Uncharacterized protein ybeB OS=Escherichia coli (... [more]
YBEB_ECOL68.818e-1236.00Uncharacterized protein ybeB OS=Escherichia coli O... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05004E10SK FlavRip1 Citrus clementina cDNA clone C05004E10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293994 ID=CX293994|Name=CX293994|organism=Citrus clementina|type=EST|length=308bp
TATTGACTGACGTCAGAGCAGACGACGTTAAGGTGATACCGGTCGGAGAG
AAATGTGATTGGACAGATTATATGGTGATTGCCACCGGTAGGTCCACGTG
GCACGTCAAGAATATCGCTCAAGCCATTATTTACAAGGCTAAGCAGAGGC
AGAGAGAGGTAGGAGCTAAGCAGATGATGCTACCCAGTGTTCAAGGGCAG
GATACAGGAAAATGGGTTATCATCGACTCTGGCAAAGTGATTGTTCACGC
ACTTGATGAGAATGCTAGAGCCTACTACAATTTGGAAGACCTTTGGACCT
CAGAGCCA
back to top