CX294324

Overview
NameCX294324
Unique NameCX294324
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length499
Libraries
Library NameType
FlavSen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX294324 vs. ExPASy Swiss-Prot
Match: OMT1_ARATH (Quercetin 3-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 4.435e-82
Identity = 137/165 (83.03%), Postives = 156/165 (94.55%), Query Frame = 3
Query:    3 KDAVLEGGIPFNKAHGMNAFDYHGKDLRFNKIFNNGMSSHSTITMKKILENYKGFEGLNSLVDVGGGIGATLNMIISKYPSIKGINFDLPHVIQDAPAFPGVQHVGGDMFVSVPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSL 497
            KDA+L+GGIPFNKA+GM+AF+YHG D RFNK+FNNGMS+HSTITMKKILE YKGFEGL SLVDVGGGIGATL MI+SKYP++KGINFDLPHVI+DAP+ PG++HVGGDMFVSVPKGDAIF+KWICHDWSDEHCVKFLKNCYE+LP +GKVI+AE ILP TPD+SL
Sbjct:  142 KDAILDGGIPFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNLKGINFDLPHVIEDAPSHPGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECILPETPDSSL 306          
BLAST of CX294324 vs. ExPASy Swiss-Prot
Match: COMT1_ROSCH (Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 1.685e-81
Identity = 138/165 (83.64%), Postives = 150/165 (90.91%), Query Frame = 3
Query:    3 KDAVLEGGIPFNKAHGMNAFDYHGKDLRFNKIFNNGMSSHSTITMKKILENYKGFEGLNSLVDVGGGIGATLNMIISKYPSIKGINFDLPHVIQDAPAFPGVQHVGGDMFVSVPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSL 497
            KDAVL+GGIPFNKA+GM AFDYHG D RFNK+FN GM+ HSTITMKKILE YKGFEGL S+VDVGGG GA +NMI+SKYPSIKGINFDLPHVI+DAP +PGVQHVGGDMFVSVPKGDAIF+KWICHDWSDEHC+KFLKNCY ALP NGKVI+ E ILPV PDTSL
Sbjct:  144 KDAVLDGGIPFNKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKILETYKGFEGLTSIVDVGGGTGAVVNMIVSKYPSIKGINFDLPHVIEDAPQYPGVQHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDTSL 308          
BLAST of CX294324 vs. ExPASy Swiss-Prot
Match: COMT1_PRUDU (Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 8.364e-81
Identity = 137/165 (83.03%), Postives = 150/165 (90.91%), Query Frame = 3
Query:    3 KDAVLEGGIPFNKAHGMNAFDYHGKDLRFNKIFNNGMSSHSTITMKKILENYKGFEGLNSLVDVGGGIGATLNMIISKYPSIKGINFDLPHVIQDAPAFPGVQHVGGDMFVSVPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSL 497
            KDAVLEGGIPFNKA+GM AF+YHG D RFNK+FN GM+ HSTITMKKILE YKGFEGL S+VDVGGG GA LNMI+SKYPSIKGINFDLPHVI+DAP +PGV+HVGGDMFVSVPKGDAIF+KWICHDWSDEHC+KFLKNCY ALP NGKVI+ E ILPV PD+SL
Sbjct:  144 KDAVLEGGIPFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSIKGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSL 308          
BLAST of CX294324 vs. ExPASy Swiss-Prot
Match: COMT1_CAPAN (Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2)

HSP 1 Score: 297.745 bits (761), Expect = 1.863e-80
Identity = 135/163 (82.82%), Postives = 151/163 (92.64%), Query Frame = 3
Query:    6 DAVLEGGIPFNKAHGMNAFDYHGKDLRFNKIFNNGMSSHSTITMKKILENYKGFEGLNSLVDVGGGIGATLNMIISKYPSIKGINFDLPHVIQDAPAFPGVQHVGGDMFVSVPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTS 494
            DAVL+GG+PFNKA+GM AF+YHG D RFNK+FN GMS HST+TMKKILE+YKGFEGLNS+VDVGGG GAT+NMI+SKYPSIKGINFDL HVI+DAPA+PGV+HVG DMFVSVPK DAIF+KWICHDWSDEHC+KFLKNCYEALP NGKV+VAE ILP TPDTS
Sbjct:  141 DAVLDGGVPFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTMTMKKILEDYKGFEGLNSIVDVGGGTGATVNMIVSKYPSIKGINFDLSHVIEDAPAYPGVEHVGRDMFVSVPKADAIFMKWICHDWSDEHCLKFLKNCYEALPANGKVLVAECILPETPDTS 303          
BLAST of CX294324 vs. ExPASy Swiss-Prot
Match: COMT1_MEDSA (Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 5.422e-80
Identity = 134/165 (81.21%), Postives = 150/165 (90.91%), Query Frame = 3
Query:    3 KDAVLEGGIPFNKAHGMNAFDYHGKDLRFNKIFNNGMSSHSTITMKKILENYKGFEGLNSLVDVGGGIGATLNMIISKYPSIKGINFDLPHVIQDAPAFPGVQHVGGDMFVSVPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSL 497
            KDAVL+GGIPFNKA+GM AF+YHG D RFNK+FN GMS HSTITMKKILE Y GFEGL SLVDVGGG GA +N I+SKYP+IKGINFDLPHVI+DAP++PGV+HVGGDMFVS+PK DA+F+KWICHDWSDEHC+KFLKNCYEALP NGKVIVAE ILPV PD+SL
Sbjct:  144 KDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSL 308          
BLAST of CX294324 vs. ExPASy Swiss-Prot
Match: COMT1_OCIBA (Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 7.081e-80
Identity = 133/164 (81.10%), Postives = 151/164 (92.07%), Query Frame = 3
Query:    6 DAVLEGGIPFNKAHGMNAFDYHGKDLRFNKIFNNGMSSHSTITMKKILENYKGFEGLNSLVDVGGGIGATLNMIISKYPSIKGINFDLPHVIQDAPAFPGVQHVGGDMFVSVPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSL 497
            DAV++GGIPFNKA+GM AF+YHG D RFNK+FN GMS+HSTITMKKILE Y GF+GL ++VDVGGG GATLNMI+SKYPSIKGINFDLPHVI+DAP++PGV+HVGGDMFVSVPKGDAIF+KWICHDWSDEHCVKFLKNCY+ALP NGKVI+AE +LP  PDT L
Sbjct:  143 DAVVDGGIPFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIVSKYPSIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYDALPQNGKVILAECVLPEAPDTGL 306          
BLAST of CX294324 vs. ExPASy Swiss-Prot
Match: COMT2_OCIBA (Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 9.248e-80
Identity = 134/165 (81.21%), Postives = 150/165 (90.91%), Query Frame = 3
Query:    3 KDAVLEGGIPFNKAHGMNAFDYHGKDLRFNKIFNNGMSSHSTITMKKILENYKGFEGLNSLVDVGGGIGATLNMIISKYPSIKGINFDLPHVIQDAPAFPGVQHVGGDMFVSVPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSL 497
            KDAVL+GGIPFNKA+GM AF+YHG D RFNK+FN GMS+HSTITMKKILE Y GF+GL ++VDVGGG GATLNMIISKYPSIKGINFDLPHV++DAP++PGV+HVGGDMFVSVPKGDAIF+KWICHDWSD HCVKFLK CYEALP NGKVI+AE +LP  PDT L
Sbjct:  142 KDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIISKYPSIKGINFDLPHVVEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDAHCVKFLKKCYEALPENGKVILAECVLPEAPDTGL 306          
BLAST of CX294324 vs. ExPASy Swiss-Prot
Match: COMT1_POPTM (Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 1.208e-79
Identity = 133/165 (80.61%), Postives = 149/165 (90.30%), Query Frame = 3
Query:    3 KDAVLEGGIPFNKAHGMNAFDYHGKDLRFNKIFNNGMSSHSTITMKKILENYKGFEGLNSLVDVGGGIGATLNMIISKYPSIKGINFDLPHVIQDAPAFPGVQHVGGDMFVSVPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSL 497
            KDA+L+GGIPFNKA+GM AF+YHG D RFNK+FN GMS HSTITMKKILE YKGFEGL SLVDVGGG GA +N I+SKYPSIKGINFDLPHVI+DAP++PGV+HVGGDMFVSVPK DA+F+KWICHDWSD HC+KFLKNCY+ALP NGKVI+ E ILPV PDTSL
Sbjct:  144 KDAILDGGIPFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSL 308          
BLAST of CX294324 vs. ExPASy Swiss-Prot
Match: COMT1_POPKI (Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 2.060e-79
Identity = 133/165 (80.61%), Postives = 148/165 (89.70%), Query Frame = 3
Query:    3 KDAVLEGGIPFNKAHGMNAFDYHGKDLRFNKIFNNGMSSHSTITMKKILENYKGFEGLNSLVDVGGGIGATLNMIISKYPSIKGINFDLPHVIQDAPAFPGVQHVGGDMFVSVPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSL 497
            KDA+LEGGIPFNKA+GM AF+YHG D RFNK+FN GMS HSTITMKKILE YKGFEGL SLVDVGGG GA +N I+SKYPSIKGINFDLPHVI+DAP++PGV+HVGGDMFVSVP  DA+F+KWICHDWSD HC+KFLKNCY+ALP NGKVI+ E ILPV PDTSL
Sbjct:  144 KDAILEGGIPFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPNADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSL 308          
BLAST of CX294324 vs. ExPASy Swiss-Prot
Match: COMT1_CATRO (Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 4.590e-79
Identity = 133/165 (80.61%), Postives = 152/165 (92.12%), Query Frame = 3
Query:    3 KDAVLEGGIPFNKAHGMNAFDYHGKDLRFNKIFNNGMSSHSTITMKKILENYKGFEGLNSLVDVGGGIGATLNMIISKYPSIKGINFDLPHVIQDAPAFPGVQHVGGDMFVSVPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSL 497
            KDAVLEGGIPFNKA+GM AF+YHGKD RFNK+FN GMS+HSTI MKKILE Y+GF+GL ++VDVGGG GATLNMI+SKYPSIKGINFDLPHVI+DAP++PGV HVGGDMFVSVPKGDAIF+KWICHDWSD HC+KFLKNC+EALP NGKVI+AE +LP  PD++L
Sbjct:  144 KDAVLEGGIPFNKAYGMTAFEYHGKDPRFNKVFNQGMSNHSTIIMKKILEIYQGFQGLKTVVDVGGGTGATLNMIVSKYPSIKGINFDLPHVIEDAPSYPGVDHVGGDMFVSVPKGDAIFMKWICHDWSDAHCLKFLKNCHEALPENGKVILAECLLPEAPDSTL 308          
The following BLAST results are available for this feature:
BLAST of CX294324 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 43
Match NameE-valueIdentityDescription
OMT1_ARATH4.435e-8283.03Quercetin 3-O-methyltransferase 1 OS=Arabidopsis t... [more]
COMT1_ROSCH1.685e-8183.64Caffeic acid 3-O-methyltransferase OS=Rosa chinens... [more]
COMT1_PRUDU8.364e-8183.03Caffeic acid 3-O-methyltransferase OS=Prunus dulci... [more]
COMT1_CAPAN1.863e-8082.82Caffeic acid 3-O-methyltransferase OS=Capsicum ann... [more]
COMT1_MEDSA5.422e-8081.21Caffeic acid 3-O-methyltransferase OS=Medicago sat... [more]
COMT1_OCIBA7.081e-8081.10Caffeic acid 3-O-methyltransferase 1 OS=Ocimum bas... [more]
COMT2_OCIBA9.248e-8081.21Caffeic acid 3-O-methyltransferase 2 OS=Ocimum bas... [more]
COMT1_POPTM1.208e-7980.61Caffeic acid 3-O-methyltransferase 1 OS=Populus tr... [more]
COMT1_POPKI2.060e-7980.61Caffeic acid 3-O-methyltransferase 1 OS=Populus ki... [more]
COMT1_CATRO4.590e-7980.61Caffeic acid 3-O-methyltransferase OS=Catharanthus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05015B11SK FlavSen1 Citrus clementina cDNA clone C05015B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294324 ID=CX294324; Name=CX294324; organism=Citrus clementina; type=EST; length=499bp
TAAAAGATGCAGTGCTTGAAGGTGGCATTCCATTTAACAAGGCCCATGGG
ATGAATGCATTCGATTACCATGGCAAAGATCTAAGATTCAACAAGATTTT
CAACAATGGAATGTCTTCTCATTCTACCATTACCATGAAGAAAATTCTTG
AAAATTACAAAGGGTTTGAAGGCCTCAACTCACTTGTCGACGTTGGTGGT
GGAATTGGAGCCACACTTAACATGATTATCTCCAAGTATCCATCGATTAA
AGGCATCAACTTTGATTTGCCACATGTTATTCAGGATGCTCCAGCTTTTC
CTGGTGTCCAGCATGTTGGGGGAGACATGTTTGTTAGTGTTCCAAAGGGA
GATGCCATTTTTATCAAGTGGATATGTCATGATTGGAGTGATGAGCACTG
CGTGAAATTCTTGAAGAACTGCTATGAAGCACTCCCAGTAAATGGGAAAG
TCATTGTTGCTGAATCTATCCTCCCAGTAACCCCGGACACGAGCCTCGC
back to top