CX294337

Overview
NameCX294337
Unique NameCX294337
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length309
Libraries
Library NameType
FlavSen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX294337 vs. ExPASy Swiss-Prot
Match: DFRA_VITVI (Dihydroflavonol-4-reductase OS=Vitis vinifera GN=DFR PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.169e-12
Identity = 43/102 (42.16%), Postives = 56/102 (54.90%), Query Frame = 3
Query:   18 AKQRLLLCKADLLDYESLKEAINGCEGVFHTASPV---TDDPE-QMVEPAVIGTKN-XXXXXXXXXXXXXXFTSSIGAVYMDPNRSPDDVVDESCWSDLEFC 308
            A+  L L KADL D  S  EAI GC GVFH A+P+   + DPE ++++P + G                  FTSS G V +  ++ P  V DESCWSD+EFC
Sbjct:   54 AETHLTLWKADLADEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLP--VYDESCWSDMEFC 153          
BLAST of CX294337 vs. ExPASy Swiss-Prot
Match: DFRA_MEDSA (Dihydroflavonol-4-reductase (Fragment) OS=Medicago sativa GN=DFR1 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 6.751e-12
Identity = 42/106 (39.62%), Postives = 60/106 (56.60%), Query Frame = 3
Query:    6 ERGGAKQRLLLCKADLLDYESLKEAINGCEGVFHTASPV---TDDPE-QMVEPAVIGTKN-XXXXXXXXXXXXXXFTSSIGAVYMDPNRSPDDVVDESCWSDLEFC 308
            E  GAK +L + KADL +  S  EAI GC GVFH A+P+   + DPE +M++P + G  +               +TSS G + +  ++ P  + DESCWSD+EFC
Sbjct:   33 ELPGAKSKLSIWKADLGEEGSFDEAIKGCTGVFHVATPMDFESKDPENEMIKPTIKGVLDIMKACLKAKTVRRLIYTSSAGTLNVTEDQKP--LWDESCWSDVEFC 136          
BLAST of CX294337 vs. ExPASy Swiss-Prot
Match: DFRA_MALDO (Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Malus domestica GN=DFR PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.351e-11
Identity = 42/102 (41.18%), Postives = 57/102 (55.88%), Query Frame = 3
Query:   18 AKQRLLLCKADLLDYESLKEAINGCEGVFHTASPV---TDDPE-QMVEPAVIGTKN-XXXXXXXXXXXXXXFTSSIGAVYMDPNRSPDDVVDESCWSDLEFC 308
            A+  L L KADL D  S  EAI GC GVFH A+P+   + DPE ++++P + G  +               FTSS G V ++ ++ P  V DES WSD+EFC
Sbjct:   54 AETHLTLWKADLADEGSFDEAIQGCSGVFHVATPMDFESKDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSSAGTVNVEEHQKP--VYDESNWSDVEFC 153          
BLAST of CX294337 vs. ExPASy Swiss-Prot
Match: DFRA_PYRCO (Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Pyrus communis GN=DFR PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.376e-11
Identity = 42/102 (41.18%), Postives = 57/102 (55.88%), Query Frame = 3
Query:   18 AKQRLLLCKADLLDYESLKEAINGCEGVFHTASPV---TDDPE-QMVEPAVIGTKN-XXXXXXXXXXXXXXFTSSIGAVYMDPNRSPDDVVDESCWSDLEFC 308
            A+  L L KADL D  S  EAI GC GVFH A+P+   + DPE ++++P + G  +               FTSS G V ++ ++ P  V DES WSD+EFC
Sbjct:   54 AETHLTLWKADLADEGSFDEAIQGCSGVFHVATPMDFESRDPENEVIKPTINGLLDILKACQKAKTVRKLVFTSSAGTVNVEEHQKP--VYDESNWSDVEFC 153          
The following BLAST results are available for this feature:
BLAST of CX294337 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
DFRA_VITVI5.169e-1242.16Dihydroflavonol-4-reductase OS=Vitis vinifera GN=D... [more]
DFRA_MEDSA6.751e-1239.62Dihydroflavonol-4-reductase (Fragment) OS=Medicago... [more]
DFRA_MALDO3.351e-1141.18Bifunctional dihydroflavonol 4-reductase/flavanone... [more]
DFRA_PYRCO4.376e-1141.18Bifunctional dihydroflavonol 4-reductase/flavanone... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05015D04SK FlavSen1 Citrus clementina cDNA clone C05015D04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294337 ID=CX294337; Name=CX294337; organism=Citrus clementina; type=EST; length=309bp
TGAGGGAGCGGGGGGGAGCAAAACAAAGATTACTTTTATGCAAAGCTGAT
CTTCTTGATTATGAGAGTCTCAAAGAGGCCATTAATGGATGTGAGGGAGT
TTTTCATACTGCTTCCCCTGTGACAGATGATCCAGAACAAATGGTGGAGC
CCGCGGTGATCGGAACCAAGAACGTGATTGTTGCGGCGGCTGAGGCCAAG
GTCCGGCGTGTTGTGTTCACGTCGTCGATCGGTGCAGTTTACATGGACCC
CAACCGGAGCCCTGATGATGTTGTTGATGAATCTTGCTGGAGTGATCTTG
AGTTTTGCA
back to top