CX294340

Overview
NameCX294340
Unique NameCX294340
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length567
Libraries
Library NameType
FlavSen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX294340 vs. ExPASy Swiss-Prot
Match: 12KD_FRAAN (Auxin-repressed 12.5 kDa protein OS=Fragaria ananassa PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.804e-24
Identity = 55/110 (50.00%), Postives = 68/110 (61.82%), Query Frame = 2
Query:   41 MLEKLWDDVVAGPQPDRGLGRLRKITTTPLAVKEGGEAESSSGKFQRSLSMXXXXXXXXXXXXXXXXXXXRKDNVWRSVFHPGSNLATRGIGAEVFDKPTHPNSPTVYDW 370
            +L+KLWDD+VAGPQP+RGLG LRK+   PL +K+ GE+           S                    RKDNVWRSVFHPGSNL+++ +G +VFD P  PNSPTVYDW
Sbjct:    3 LLDKLWDDIVAGPQPERGLGMLRKVPQ-PLNLKDEGES-----------SKITMPTTPTTPVTPTTPISARKDNVWRSVFHPGSNLSSKTMGNQVFDSP-QPNSPTVYDW 99          

HSP 2 Score: 27.335 bits (59), Expect = 2.804e-24
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 3
Query:  375 LYSGETRSKHH 407
            +YSGETRSKHH
Sbjct:  100 MYSGETRSKHH 110          
The following BLAST results are available for this feature:
BLAST of CX294340 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
12KD_FRAAN2.804e-2450.00Auxin-repressed 12.5 kDa protein OS=Fragaria anana... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05015D07SK FlavSen1 Citrus clementina cDNA clone C05015D07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294340 ID=CX294340; Name=CX294340; organism=Citrus clementina; type=EST; length=567bp
TAAAGATTTAGAAACTAGCAGCTAAATTGTAAATTTAAAGATGCTAGAGA
AGCTTTGGGACGATGTTGTGGCAGGGCCTCAGCCTGATCGTGGCCTTGGC
AGGCTGAGGAAAATCACCACAACACCCTTAGCAGTCAAAGAGGGTGGTGA
GGCGGAGTCGTCGTCGGGCAAGTTCCAGAGGTCTCTGTCAATGCCAGCGA
GTCCAGGGGCACCGTCGACGCCAGTGACGCCGACGACGCCGCTGTCGGCG
CGTAAGGACAACGTGTGGAGGAGCGTGTTTCACCCCGGTAGCAACCTTGC
TACTAGGGGTATCGGTGCAGAGGTCTTTGACAAGCCCACACATCCTAACT
CTCCCACTGTTTATGACTGGTAAGCTTTACAGTGGGGAGACTAGGAGCAA
GCATCATCACTGAGTGGATGATACGCTCCAGCGATGTAAATGAATGTGAT
GGGTCACCAACTCACCGGATGAGTTGCCTGTAGTCTGTAGATAGTGTCGT
TTCGTTTTGGATTTCGCACGTGTCCTTGTCGTTTTGTTATGCTATTTTAT
TACGTGTCCTTCTATCT
back to top