CX294345

Overview
NameCX294345
Unique NameCX294345
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length650
Libraries
Library NameType
FlavSen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX294345 vs. ExPASy Swiss-Prot
Match: CAMT_POPTM (Caffeoyl-CoA O-methyltransferase OS=Populus tremuloides PE=2 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 9.730e-80
Identity = 140/190 (73.68%), Postives = 169/190 (88.95%), Query Frame = 3
Query:    3 AAGREGQEENKDRYYKTLHGNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSAMMTAPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYD 572
            A   E Q+    R+ +   G+K+LLQS+ LY+YILETSVYPREP+C+KE+RE+T KHPW+ M T+ DE QFL+MLLKL+NAKNTMEIGV+TGYSLLATALAIP+DGKILA+DI +E+YE GLP+IQKAGVAHKIDF+EGPALP+LDQ+I+D KYHG+FDF+FVDADK+NYINYHKRLIELVKVGG+IGYD
Sbjct:    2 ATNGEEQQSQAGRHQEV--GHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEGQFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIGYD 189          
BLAST of CX294345 vs. ExPASy Swiss-Prot
Match: CAMT2_POPTR (Caffeoyl-CoA O-methyltransferase 2 OS=Populus trichocarpa GN=CCOAOMT2 PE=2 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 1.271e-79
Identity = 141/190 (74.21%), Postives = 169/190 (88.95%), Query Frame = 3
Query:    3 AAGREGQEENKDRYYKTLHGNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSAMMTAPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYD 572
            AA  E Q+    R+ +   G+K+LLQS+ LY+YILETSVYPREP+C+KE+RELT KHPW+ M T+ DE QFL+MLLKLINAKNTMEIGVFTGYSLLATALAIP+DGKILA+DI +E+YE GLP+IQKAG+ HKI+F+EGPALP+LDQ+I+D KYHGT+DF+FVDADK+NYINYHKRLIELVKVGG+IGYD
Sbjct:    2 AANGEEQQTQAGRHQEV--GHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEGQFLNMLLKLINAKNTMEIGVFTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAGLEHKIEFKEGPALPVLDQMIEDGKYHGTYDFIFVDADKDNYINYHKRLIELVKVGGLIGYD 189          
BLAST of CX294345 vs. ExPASy Swiss-Prot
Match: CAMT1_POPTR (Caffeoyl-CoA O-methyltransferase 1 OS=Populus trichocarpa GN=CCOAOMT1 PE=2 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.076e-78
Identity = 139/190 (73.16%), Postives = 168/190 (88.42%), Query Frame = 3
Query:    3 AAGREGQEENKDRYYKTLHGNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSAMMTAPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYD 572
            A   E Q+    R+ +   G+K+LLQS+ LY+YILETSVYPREP+C+KE+RE+T KHPW+ M T+ DE QFL+MLLKL+NAKNTMEIGV+TGYSLLATALAIP+DGKILA+DI +E+YE GLP+IQKAGVAHKIDF+EGPALP+LDQ+I+D K HG+FDF+FVDADK+NYINYHKRLIELVKVGG+IGYD
Sbjct:    2 ATNGEEQQSQAGRHQEV--GHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEGQFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKCHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIGYD 189          
BLAST of CX294345 vs. ExPASy Swiss-Prot
Match: CAMT_VITVI (Caffeoyl-CoA O-methyltransferase OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 2.397e-78
Identity = 135/171 (78.95%), Postives = 161/171 (94.15%), Query Frame = 3
Query:   60 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSAMMTAPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYD 572
            G+K+LLQS+ LY+YILETSVYPREP+ +KE+RELT +HPW+ M T+ DE QFL+MLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILA+DI KE+YE GLP+IQKAGVAHKIDF+EGPALP+LDQ+I+D KYHG+FDF+FVDADK+NY+NYHKRLI+LVKVGG+IGYD
Sbjct:   14 GHKSLLQSDALYQYILETSVYPREPESMKELRELTAQHPWNIMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIDLVKVGGIIGYD 184          
BLAST of CX294345 vs. ExPASy Swiss-Prot
Match: CAMT2_EUCGL (Caffeoyl-CoA O-methyltransferase 2 OS=Eucalyptus globulus GN=CCOAOMT2 PE=2 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 2.397e-78
Identity = 139/190 (73.16%), Postives = 169/190 (88.95%), Query Frame = 3
Query:    3 AAGREGQEENKDRYYKTLHGNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSAMMTAPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYD 572
            AA  E Q+    ++ +   G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHPW+ M T+ DE QFL+MLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILA+DI +E++E GLP+I+KAG+AHKIDFREGPALPLLDQL+QDEK HGT+DF+FVDADK+NYINYHKRLI+LVKVGG+IGYD
Sbjct:    2 AANAEPQQTQPAKHSEV--GHKSLLQSDALYQYILETSVYPREPESMKELREITAKHPWNLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENFEIGLPVIEKAGLAHKIDFREGPALPLLDQLVQDEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGLIGYD 189          
BLAST of CX294345 vs. ExPASy Swiss-Prot
Match: CAMT_SOLTU (Caffeoyl-CoA O-methyltransferase OS=Solanum tuberosum GN=CCOAOMT PE=2 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 2.029e-77
Identity = 132/171 (77.19%), Postives = 161/171 (94.15%), Query Frame = 3
Query:   60 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSAMMTAPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYD 572
            G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHPW+ M T+ DE QFL+MLLKLINAKNTMEIGVFTGYSLLATA+A+PDDGKILA+DI +E+YE GLP+I+KAG+AHKIDFREGPALP+LDQ+I+D KYHG++DF+FVDADK+NY+NYHKRLI+LVKVGG+IGYD
Sbjct:   14 GHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSADEGQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIEKAGLAHKIDFREGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGLIGYD 184          
BLAST of CX294345 vs. ExPASy Swiss-Prot
Match: CAMT_PETCR (Caffeoyl-CoA O-methyltransferase OS=Petroselinum crispum PE=1 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 2.029e-77
Identity = 134/171 (78.36%), Postives = 159/171 (92.98%), Query Frame = 3
Query:   60 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSAMMTAPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYD 572
            G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHPW+ M T+ DE QFL+MLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILA+DI +E+YE GLPII+KAGV HKIDFREGPALP+LD +++D KYHGTFDFVFVDADK+NYINYHKRLI+LVK+GG+IGYD
Sbjct:   13 GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEIGLPIIEKAGVGHKIDFREGPALPVLDHMLEDGKYHGTFDFVFVDADKDNYINYHKRLIDLVKIGGLIGYD 183          
BLAST of CX294345 vs. ExPASy Swiss-Prot
Match: CAMT5_TOBAC (Caffeoyl-CoA O-methyltransferase 5 OS=Nicotiana tabacum GN=CCOAOMT5 PE=2 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 3.461e-77
Identity = 134/171 (78.36%), Postives = 161/171 (94.15%), Query Frame = 3
Query:   60 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSAMMTAPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYD 572
            G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHPW+ M T+ DE QFL+MLLKLINAKNTMEIGV+TGYSLLATALAIPDDGKILA+DI +E+YE GLPII+KAGVAHKI+FREGPALP+LDQL++D+K HGT+DF+FVDADK+NYINYHKR+I+LVKVGG+IGYD
Sbjct:   12 GHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINRENYEIGLPIIEKAGVAHKIEFREGPALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLIGYD 182          
BLAST of CX294345 vs. ExPASy Swiss-Prot
Match: CAMT_ZINEL (Caffeoyl-CoA O-methyltransferase OS=Zinnia elegans GN=CCOAOMT PE=2 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 5.903e-77
Identity = 135/171 (78.95%), Postives = 159/171 (92.98%), Query Frame = 3
Query:   60 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSAMMTAPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYD 572
            G+K+LLQS+ LY+YILETSVYPREPQ +KE+R +T KHPW+ M T+ DE QFL++LLKLINAKNTMEIGV+TGYSLL+TALA+P+DGKILALDI +E+YE GLPIIQKAGVAHKIDFREGPALPLLDQ++QDEK HG+FDF+FVDADK+NY+NYHKRLI+LVK GGVIGYD
Sbjct:   17 GHKSLLQSDALYQYILETSVYPREPQPMKELRRITAKHPWNLMTTSADEGQFLNLLLKLINAKNTMEIGVYTGYSLLSTALALPEDGKILALDINRENYEIGLPIIQKAGVAHKIDFREGPALPLLDQMLQDEKCHGSFDFIFVDADKDNYLNYHKRLIDLVKFGGVIGYD 187          
BLAST of CX294345 vs. ExPASy Swiss-Prot
Match: CAMT4_ARATH (Probable caffeoyl-CoA O-methyltransferase At4g34050 OS=Arabidopsis thaliana GN=At4g34050 PE=2 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 7.709e-77
Identity = 132/186 (70.97%), Postives = 170/186 (91.40%), Query Frame = 3
Query:   15 EGQEENKDRYYKTLHGNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSAMMTAPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYD 572
            E Q+++++  ++ + G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHPW+ M T+ DE QFL+ML+KL+NAKNTMEIGV+TGYSLLATALA+P+DGKILA+D+ +E+YE GLPII+KAGVAHKIDFREGPALP+LD+++ DEK HGT+DF+FVDADK+NYINYHKRLI+LVK+GGVIGYD
Sbjct:   17 EDQKQSQNLRHQEV-GHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKIGGVIGYD 201          
The following BLAST results are available for this feature:
BLAST of CX294345 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 33
Match NameE-valueIdentityDescription
CAMT_POPTM9.730e-8073.68Caffeoyl-CoA O-methyltransferase OS=Populus tremul... [more]
CAMT2_POPTR1.271e-7974.21Caffeoyl-CoA O-methyltransferase 2 OS=Populus tric... [more]
CAMT1_POPTR1.076e-7873.16Caffeoyl-CoA O-methyltransferase 1 OS=Populus tric... [more]
CAMT_VITVI2.397e-7878.95Caffeoyl-CoA O-methyltransferase OS=Vitis vinifera... [more]
CAMT2_EUCGL2.397e-7873.16Caffeoyl-CoA O-methyltransferase 2 OS=Eucalyptus g... [more]
CAMT_SOLTU2.029e-7777.19Caffeoyl-CoA O-methyltransferase OS=Solanum tubero... [more]
CAMT_PETCR2.029e-7778.36Caffeoyl-CoA O-methyltransferase OS=Petroselinum c... [more]
CAMT5_TOBAC3.461e-7778.36Caffeoyl-CoA O-methyltransferase 5 OS=Nicotiana ta... [more]
CAMT_ZINEL5.903e-7778.95Caffeoyl-CoA O-methyltransferase OS=Zinnia elegans... [more]
CAMT4_ARATH7.709e-7770.97Probable caffeoyl-CoA O-methyltransferase At4g3405... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05015E05SK FlavSen1 Citrus clementina cDNA clone C05015E05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294345 ID=CX294345; Name=CX294345; organism=Citrus clementina; type=EST; length=650bp
GGGCTGCAGGTCGGGAAGGTCAGGAGGAAAACAAGGATCGTTACTACAAA
ACTCTACATGGGAACAAGACCCTTTTACAGAGTGAAAAACTTTATGAGTA
TATACTTGAAACCAGTGTATATCCAAGAGAACCACAATGCTTGAAGGAGA
TCCGCGAGTTGACGGACAAGCATCCATGGAGCGCCATGATGACTGCACCT
GATGAAGCACAATTTTTGAGCATGCTACTCAAGCTTATCAATGCCAAGAA
TACCATGGAAATTGGCGTTTTCACTGGTTACTCTCTCCTAGCCACTGCCC
TCGCCATTCCCGACGATGGCAAGATACTGGCCCTGGACATCACCAAGGAA
CACTACGAGAAGGGTCTCCCTATAATTCAAAAAGCTGGTGTTGCCCACAA
GATTGATTTCAGAGAAGGCCCTGCTCTTCCTCTTCTTGATCAATTGATCC
AAGACGAAAAATATCATGGGACATTCGACTTCGTCTTTGTTGATGCTGAC
AAGAATAACTACATTAATTACCACAAGAGGCTTATTGAGCTTGTGAAGGT
TGGGGGAGTGATTGGCTACGACACACCTTGTGGGGTGATCTGTGGTGGCA
CACCTGATGCGACCTGATGAGCTATCTTAGCTGGAGGATCTGTGCAGACT
back to top