CX294779

Overview
NameCX294779
Unique NameCX294779
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length611
Libraries
Library NameType
FlavSen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13920 contig Ccv1_Contig13920:587..1197. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX294779 vs. ExPASy Swiss-Prot
Match: ORYA_ORYSJ (Oryzain alpha chain OS=Oryza sativa subsp. japonica GN=Os04g0650000 PE=1 SV=2)

HSP 1 Score: 312.768 bits (800), Expect = 8.923e-85
Identity = 149/185 (80.54%), Postives = 163/185 (88.11%), Query Frame = 2
Query:    5 IAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASY 559
            IAAVEGIN+IVTG LISLSEQELVDCDTSYNEGCNGGLMDYAF+FII+NGGIDTE+DYPYK  D  CD  RKNAKVVTID YEDV  N E +LQKAVANQPVSVAIE GG AFQLY SGIFTG+CGT+LDHGV AVGYGTENG DYWIV+NSWG SWGE+GY+RMERN+  + +GKCGIA+E SY
Sbjct:  159 IAAVEGINQIVTGDLISLSEQELVDCDTSYNEGCNGGLMDYAFDFIINNGGIDTEDDYPYKGKDERCDVNRKNAKVVTIDSYEDVTPNSETSLQKAVANQPVSVAIEAGGRAFQLYSSGIFTGKCGTALDHGVAAVGYGTENGKDYWIVRNSWGKSWGESGYVRMERNIKAS-SGKCGIAVEPSY 342          
BLAST of CX294779 vs. ExPASy Swiss-Prot
Match: RD21A_ARATH (Cysteine proteinase RD21a OS=Arabidopsis thaliana GN=RD21A PE=1 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 4.429e-84
Identity = 144/186 (77.42%), Postives = 164/186 (88.17%), Query Frame = 2
Query:    2 TIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASY 559
            TI AVEGIN+IVTG LI+LSEQELVDCDTSYNEGCNGGLMDYAFEFII NGGIDT++DYPYK +DG+CD  RKNAKVVTID YEDVP   E++L+KAVA+QP+S+AIE GG AFQLY+SGIF G CGT LDHGV AVGYGTENG DYWIV+NSWG SWGE+GY+RM RN+A + +GKCGIA+E SY
Sbjct:  166 TIGAVEGINQIVTGDLITLSEQELVDCDTSYNEGCNGGLMDYAFEFIIKNGGIDTDKDYPYKGVDGTCDQIRKNAKVVTIDSYEDVPTYSEESLKKAVAHQPISIAIEAGGRAFQLYDSGIFDGSCGTQLDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYLRMARNIASS-SGKCGIAIEPSY 350          
BLAST of CX294779 vs. ExPASy Swiss-Prot
Match: GCP1_ARATH (Germination-specific cysteine protease 1 OS=Arabidopsis thaliana GN=GCP1 PE=2 SV=2)

HSP 1 Score: 294.664 bits (753), Expect = 2.515e-79
Identity = 135/186 (72.58%), Postives = 159/186 (85.48%), Query Frame = 2
Query:    2 TIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASY 559
            T AAVEGINKIVTG LISLSEQELVDCD SYN+GCNGGLMDYAF+FI+ NGG++TE+DYPY+   G C+++ KN++VV+ID YEDVP  DE AL+KA++ QPVSVAIE GG  FQ Y+SGIFTG CGT+LDH V AVGYG+ENG DYWIV+NSWG  WGE GYIRMERN+A + +GKCGIA+EASY
Sbjct:  174 TTAAVEGINKIVTGELISLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPYRGFGGKCNSFLKNSRVVSIDGYEDVPTKDETALKKAISYQPVSVAIEAGGRIFQHYQSGIFTGSCGTNLDHAVVAVGYGSENGVDYWIVRNSWGPRWGEEGYIRMERNLAASKSGKCGIAVEASY 359          
BLAST of CX294779 vs. ExPASy Swiss-Prot
Match: ORYB_ORYSJ (Oryzain beta chain OS=Oryza sativa subsp. japonica GN=Os04g0670200 PE=1 SV=2)

HSP 1 Score: 291.197 bits (744), Expect = 2.780e-78
Identity = 137/186 (73.66%), Postives = 160/186 (86.02%), Query Frame = 2
Query:    5 IAAVEGINKIVTGSLISLSEQELVDCDTS-YNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASY 559
            ++ VE IN++VTG +I+LSEQELV+C T+  N GCNGGLMD AF+FII NGGIDTE+DYPYKA+DG CD  R+NAKVV+ID +EDVP NDEK+LQKAVA+QPVSVAIE GG  FQLY SG+F+GRCGTSLDHGV AVGYGT+NG DYWIV+NSWG  WGE+GY+RMERN+  T TGKCGIAM ASY
Sbjct:  171 VSTVESINQLVTGEMITLSEQELVECSTNGQNSGCNGGLMDDAFDFIIKNGGIDTEDDYPYKAVDGKCDINRENAKVVSIDGFEDVPQNDEKSLQKAVAHQPVSVAIEAGGREFQLYHSGVFSGRCGTSLDHGVVAVGYGTDNGKDYWIVRNSWGPKWGESGYVRMERNINVT-TGKCGIAMMASY 355          
BLAST of CX294779 vs. ExPASy Swiss-Prot
Match: CYSP4_BRANA (Cysteine proteinase COT44 (Fragment) OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 4.743e-78
Identity = 135/186 (72.58%), Postives = 161/186 (86.56%), Query Frame = 2
Query:    2 TIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASY 559
            T AAVEGINKIVTG L+SLSEQELVDCD SYN+GCNGGLMDYAF+FI+ NGG++TE+DYPY   +G C++  KN++VVTID YEDVP  DE AL++AV+ QPVSVAI+ GG AFQ Y+SGIFTG+CGT++DH V AVGYG+ENG DYWIV+NSWG+ WGE GYIRMERNVA + +GKCGIA+EASY
Sbjct:  129 TAAAVEGINKIVTGELVSLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPYHGTNGKCNSLLKNSRVVTIDGYEDVPSKDETALKRAVSYQPVSVAIDAGGRAFQHYQSGIFTGKCGTNMDHAVVAVGYGSENGVDYWIVRNSWGTRWGEDGYIRMERNVA-SKSGKCGIAIEASY 313          
BLAST of CX294779 vs. ExPASy Swiss-Prot
Match: CYSPL_SOLLC (Low-temperature-induced cysteine proteinase (Fragment) OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 4.015e-77
Identity = 134/185 (72.43%), Postives = 160/185 (86.49%), Query Frame = 2
Query:    5 IAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASY 559
            +AA+E IN IVTG+LISLSEQELVDCD SYNEGC+GGLMDYAFEF+I NGGIDTEEDYPYK  +G CD YRKNAKVV ID YEDVP+N+EKALQKAVA+QPVS+A+E GG  FQ Y+SGIFTG+CGT++DHGV   GYGTENG DYWIV+NSWG++  E GY+R++RNV+ + +G CG+A+E SY
Sbjct:   48 VAAMESINAIVTGNLISLSEQELVDCDRSYNEGCDGGLMDYAFEFVIKNGGIDTEEDYPYKERNGVCDQYRKNAKVVKIDSYEDVPVNNEKALQKAVAHQPVSIALEAGGRDFQHYKSGIFTGKCGTAVDHGVVIAGYGTENGMDYWIVRNSWGANCRENGYLRVQRNVSSS-SGLCGLAIEPSY 231          
BLAST of CX294779 vs. ExPASy Swiss-Prot
Match: CYSP1_ORYSJ (Cysteine protease 1 OS=Oryza sativa subsp. japonica GN=CP1 PE=2 SV=2)

HSP 1 Score: 269.24 bits (687), Expect = 1.131e-71
Identity = 132/188 (70.21%), Postives = 153/188 (81.38%), Query Frame = 2
Query:    5 IAAVEGINKIVTGSLISLSEQELVDCDTS-YNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTE--NGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASY 559
            +AAVEGINKIVTG L+SLSEQELV+C  +  N GCNGG+MD AF FI  NGG+DTEEDYPY A+DG C+  +++ KVV+ID +EDVP NDE +LQKAVA+QPVSVAI+ GG  FQLY+SG+FTGRCGT+LDHGV AVGYGT+   GA YW V+NSWG  WGE GYIRMERNV    TGKCGIAM ASY
Sbjct:  186 VAAVEGINKIVTGELVSLSEQELVECARNGQNSGCNGGIMDDAFAFIARNGGLDTEEDYPYTAMDGKCNLAKRSRKVVSIDGFEDVPENDELSLQKAVAHQPVSVAIDAGGREFQLYDSGVFTGRCGTNLDHGVVAVGYGTDAATGAAYWTVRNSWGPDWGENGYIRMERNVTAR-TGKCGIAMMASY 372          
BLAST of CX294779 vs. ExPASy Swiss-Prot
Match: CYSP_HEMSP (Thiol protease SEN102 OS=Hemerocallis sp. GN=SEN102 PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 2.359e-69
Identity = 127/187 (67.91%), Postives = 147/187 (78.61%), Query Frame = 2
Query:    2 TIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYG-TENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASY 559
            TIA+VEGIN+I TG L+SLSEQELVDCDTSYNEGCNGGLMDYAFEFI  NG I TE+ YPY   DG+C +   N+ VV+ID ++DVP N+E AL +AVANQP+SV+IE  G  FQ Y  G+FTGRCGT LDHGV  VGYG T +G  YWIVKNSWG  WGE+GYIRM+R ++    GKCGIAMEASY
Sbjct:  159 TIASVEGINQIKTGELVSLSEQELVDCDTSYNEGCNGGLMDYAFEFIQKNG-ITTEDSYPYAEQDGTCASNLLNSPVVSIDGHQDVPANNENALMQAVANQPISVSIEASGYGFQFYSEGVFTGRCGTELDHGVAIVGYGATRDGTKYWIVKNSWGEEWGESGYIRMQRGISDK-RGKCGIAMEASY 343          
BLAST of CX294779 vs. ExPASy Swiss-Prot
Match: CYSEP_RICCO (Vignain OS=Ricinus communis GN=CYSEP PE=1 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 2.359e-69
Identity = 127/187 (67.91%), Postives = 143/187 (76.47%), Query Frame = 2
Query:    2 TIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTE-NGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASY 559
            TI AVEGIN+I T  L+SLSEQELVDCDT  N+GCNGGLMDYAFEFI   GGI TE +YPY+A DG+CD  ++NA  V+ID +E+VP NDE AL KAVANQPVSVAI+ GG  FQ Y  G+FTG CGT LDHGV  VGYGT  +G  YW VKNSWG  WGE GYIRMER ++    G CGIAMEASY
Sbjct:  155 TIVAVEGINQIKTNKLVSLSEQELVDCDTDQNQGCNGGLMDYAFEFIKQRGGITTEANYPYEAYDGTCDVSKENAPAVSIDGHENVPENDENALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGSCGTELDHGVAIVGYGTTIDGTKYWTVKNSWGPEWGEKGYIRMERGISDK-EGLCGIAMEASY 340          
BLAST of CX294779 vs. ExPASy Swiss-Prot
Match: XCP2_ARATH (Xylem cysteine proteinase 2 OS=Arabidopsis thaliana GN=XCP2 PE=1 SV=2)

HSP 1 Score: 252.292 bits (643), Expect = 1.431e-66
Identity = 116/186 (62.37%), Postives = 144/186 (77.42%), Query Frame = 2
Query:    2 TIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVANQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASY 559
            T+AAVEGINKIVTG+L +LSEQEL+DCDT+YN GCNGGLMDYAFE+I+ NGG+  EEDYPY   +G+C+  +  ++ VTI+ ++DVP NDEK+L KA+A+QP+SVAI+  G  FQ Y  G+F GRCG  LDHGV AVGYG+  G+DY IVKNSWG  WGE GYIR++RN  G   G CGI   AS+
Sbjct:  167 TVAAVEGINKIVTGNLTTLSEQELIDCDTTYNNGCNGGLMDYAFEYIVKNGGLRKEEDYPYSMEEGTCEMQKDESETVTINGHQDVPTNDEKSLLKALAHQPLSVAIDASGREFQFYSGGVFDGRCGVDLDHGVAAVGYGSSKGSDYIIVKNSWGPKWGEKGYIRLKRN-TGKPEGLCGINKMASF 351          
The following BLAST results are available for this feature:
BLAST of CX294779 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 172
Match NameE-valueIdentityDescription
ORYA_ORYSJ8.923e-8580.54Oryzain alpha chain OS=Oryza sativa subsp. japonic... [more]
RD21A_ARATH4.429e-8477.42Cysteine proteinase RD21a OS=Arabidopsis thaliana ... [more]
GCP1_ARATH2.515e-7972.58Germination-specific cysteine protease 1 OS=Arabid... [more]
ORYB_ORYSJ2.780e-7873.66Oryzain beta chain OS=Oryza sativa subsp. japonica... [more]
CYSP4_BRANA4.743e-7872.58Cysteine proteinase COT44 (Fragment) OS=Brassica n... [more]
CYSPL_SOLLC4.015e-7772.43Low-temperature-induced cysteine proteinase (Fragm... [more]
CYSP1_ORYSJ1.131e-7170.21Cysteine protease 1 OS=Oryza sativa subsp. japonic... [more]
CYSP_HEMSP2.359e-6967.91Thiol protease SEN102 OS=Hemerocallis sp. GN=SEN10... [more]
CYSEP_RICCO2.359e-6967.91Vignain OS=Ricinus communis GN=CYSEP PE=1 SV=1[more]
XCP2_ARATH1.431e-6662.37Xylem cysteine proteinase 2 OS=Arabidopsis thalian... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05055H01SK FlavSen1 Citrus clementina cDNA clone C05055H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294779 ID=CX294779|Name=CX294779|organism=Citrus clementina|type=EST|length=611bp
AACCATTGCAGCTGTAGAGGGTATAAACAAGATTGTTACAGGTAGCCTGA
TCTCACTATCCGAGCAGGAGTTGGTGGATTGTGATACATCATATAATGAA
GGATGTAATGGTGGTTTGATGGACTATGCATTCGAGTTCATTATTGATAA
TGGAGGTATTGACACAGAAGAAGATTACCCCTACAAAGCCATTGATGGTA
GCTGTGACACATATCGGAAAAATGCCAAAGTAGTTACAATTGATGACTAT
GAAGATGTTCCCCTAAATGACGAGAAAGCTTTGCAAAAGGCAGTTGCAAA
TCAACCCGTGAGTGTTGCCATTGAAGGAGGTGGCATGGCATTCCAGTTAT
ATGAATCGGGTATATTTACGGGAAGATGTGGGACATCTCTGGACCATGGT
GTTACTGCTGTTGGATATGGCACAGAAAATGGAGCTGATTACTGGATTGT
GAAGAATTCATGGGGCAGTAGCTGGGGAGAGGCTGGCTATATTAGGATGG
AGCGTAACGTGGCTGGCACTCTCACGGGCAAGTGTGGAATTGCCATGGAG
GCCTCATATCCCATAAAGAAAGGCCAAAATCCTCCCAACCCTGGACCGTC
CCCTCCATCTC
back to top