CX294781

Overview
NameCX294781
Unique NameCX294781
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length629
Libraries
Library NameType
FlavSen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10184 contig Ccv1_Contig10184:34..662. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX294781 vs. ExPASy Swiss-Prot
Match: PSB5B_ARATH (Proteasome subunit beta type-5-B OS=Arabidopsis thaliana GN=PBE2 PE=1 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 9.696e-82
Identity = 153/180 (85.00%), Postives = 161/180 (89.44%), Query Frame = 1
Query:   58 MKLDTSGLESTSPF--FGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKG 591
            MKLDTSGLE+T P   FGS  E+    S+APSF LP +TDFD FQK     +K AKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDETGPGLYYVD+EGGRLKG
Sbjct:    1 MKLDTSGLETTMPVIGFGSNSEMLDGFSSAPSFDLPRTTDFDGFQKKAVEMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG 180          
BLAST of CX294781 vs. ExPASy Swiss-Prot
Match: PSB5A_ARATH (Proteasome subunit beta type-5-A OS=Arabidopsis thaliana GN=PBE1 PE=1 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.266e-81
Identity = 151/180 (83.89%), Postives = 161/180 (89.44%), Query Frame = 1
Query:   58 MKLDTSGLESTSPF--FGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKG 591
            MKLDTSG E++ P   FGS  ++  ELS+ PSF LP + +FD FQK  K  LKHAKGTTTLAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISV+GASKLLAN+LYSYRGMGLSVGTMIAGWDETGPGLYYVD+EGGRLKG
Sbjct:    1 MKLDTSGFETSMPMIGFGSSSDMLDELSSVPSFDLPRTKEFDGFQKKAKDMLKHAKGTTTLAFIFKGGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKG 180          
BLAST of CX294781 vs. ExPASy Swiss-Prot
Match: PSB5_SPIOL (Proteasome subunit beta type-5 OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 1.654e-81
Identity = 152/178 (85.39%), Postives = 157/178 (88.20%), Query Frame = 1
Query:   58 MKLDTSGLESTSPFFGSGDELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKG 591
            MKLDTSGLEST+P F   D +   L   PSF LP  TDFD FQK+    +K AKGTTTLAFIFK GVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILY+YRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKG
Sbjct:    1 MKLDTSGLESTAPIFRRSDFVFDGLQMTPSFDLPNPTDFDGFQKEAVQMVKPAKGTTTLAFIFKHGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYNYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKG 178          
BLAST of CX294781 vs. ExPASy Swiss-Prot
Match: PSB5_BOVIN (Proteasome subunit beta type-5 OS=Bos taurus GN=PSMB5 PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.669e-49
Identity = 100/167 (59.88%), Postives = 123/167 (73.65%), Query Frame = 1
Query:   97 FFGSGD--ELCPELSAAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKG 591
            FFG G   +L      +PS  L L+       ++ +  + H  GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV  ASKLLAN++Y Y+GMGLS+GTMI GWD+ GPGLYYVDSEG R+ G
Sbjct:   18 FFGLGGRADLLDLGPGSPSDGLSLAAPSWGVPEEPRIEILH--GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISG 182          
BLAST of CX294781 vs. ExPASy Swiss-Prot
Match: PSB5_RAT (Proteasome subunit beta type-5 OS=Rattus norvegicus GN=Psmb5 PE=1 SV=3)

HSP 1 Score: 193.741 bits (491), Expect = 6.343e-49
Identity = 96/152 (63.16%), Postives = 118/152 (77.63%), Query Frame = 1
Query:  136 AAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKG 591
            AAPS+ +P         ++ +  + H  GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV  ASKLLAN++Y Y+GMGLS+GTMI GWD+ GPGLYYVDSEG R+ G
Sbjct:   42 AAPSWGVP---------EEPRIEMLH--GTTTLAFKFQHGVIVAADSRATAGPYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISG 182          
BLAST of CX294781 vs. ExPASy Swiss-Prot
Match: PSB5_MOUSE (Proteasome subunit beta type-5 OS=Mus musculus GN=Psmb5 PE=1 SV=3)

HSP 1 Score: 193.741 bits (491), Expect = 6.343e-49
Identity = 100/165 (60.61%), Postives = 122/165 (73.94%), Query Frame = 1
Query:  136 AAPSFALPLSTDFDEFQKDTKATLKHAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGHG-SLWIRFTYAY 627
            AAPS+ +P         ++ +  + H  GTTTLAF F  GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV  ASKLLAN++Y Y+GMGLS+GTMI GWD+ GPGLYYVDSEG R+ G   S+     YAY
Sbjct:   42 AAPSWGVP---------EEPRIEMLH--GTTTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAY 195          
BLAST of CX294781 vs. ExPASy Swiss-Prot
Match: PSB5_PONAB (Proteasome subunit beta type-5 OS=Pongo abelii GN=PSMB5 PE=2 SV=3)

HSP 1 Score: 192.971 bits (489), Expect = 1.082e-48
Identity = 90/124 (72.58%), Postives = 106/124 (85.48%), Query Frame = 1
Query:  220 GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKG 591
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV  ASKLLAN++Y Y+GMGLS+GTMI GWD+ GPGLYYVDSEG R+ G
Sbjct:   59 GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISG 182          
BLAST of CX294781 vs. ExPASy Swiss-Prot
Match: PSB5_HUMAN (Proteasome subunit beta type-5 OS=Homo sapiens GN=PSMB5 PE=1 SV=3)

HSP 1 Score: 192.971 bits (489), Expect = 1.082e-48
Identity = 90/124 (72.58%), Postives = 106/124 (85.48%), Query Frame = 1
Query:  220 GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKG 591
            GTTTLAF F+ GV+VAADSRA+ G YI+SQ+VKK+IEINPY+LGTMAGGAADC FW R L  +CR++EL NK RISV  ASKLLAN++Y Y+GMGLS+GTMI GWD+ GPGLYYVDSEG R+ G
Sbjct:   59 GTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISG 182          
BLAST of CX294781 vs. ExPASy Swiss-Prot
Match: PSB5_DICDI (Proteasome subunit beta type-5 OS=Dictyostelium discoideum GN=psmB5 PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.013e-46
Identity = 94/169 (55.62%), Postives = 122/169 (72.19%), Query Frame = 1
Query:  142 PSFALPLSTDFDEFQKDT------KATLKHAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGHG-SLWIRFTYAY 627
            P F LP + +  +F ++T         L+ A GTTTLAF++  G++V+ DS+++ G Y++S+SVKK+IEI P +LGTMAGGAADC FW R LG +CRL+EL NK  ISV  ASK+LANI+YSY+G GLS+GTMI GWD+TGP LYYVD++G RL G   S     TYAY
Sbjct:   30 PHFELPPNANPGDFLRETFDHPSAPKALEFAHGTTTLAFVYGGGIIVSVDSKSTQGPYVASRSVKKVIEITPTLLGTMAGGAADCSFWERELGRRCRLYELRNKELISVAAASKILANIVYSYKGYGLSMGTMITGWDKTGPQLYYVDNDGTRLHGQRFSCGSGSTYAY 198          
BLAST of CX294781 vs. ExPASy Swiss-Prot
Match: PSB5_CHICK (Proteasome subunit beta type-5 (Fragment) OS=Gallus gallus GN=PSMB5 PE=2 SV=2)

HSP 1 Score: 181.415 bits (459), Expect = 3.258e-45
Identity = 89/137 (64.96%), Postives = 108/137 (78.83%), Query Frame = 1
Query:  220 GTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGHG-SLWIRFTYAY 627
            GTTTLAF F  GV+VA DSRA+ G YI+SQ+V+K+IEINP +LGTMAGGAADC FW R L  +CR++EL NK  ISV  ASKLLAN++Y Y+GMGLS+GTMI GWD+ GPGLYYVDSEG R+ G   ++    +YAY
Sbjct:   55 GTTTLAFKFAHGVVVAVDSRATAGSYIASQTVQKVIEINPSLLGTMAGGAADCSFWERLLARQCRVYELRNKEPISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGTRIPGEAFAVGSGSSYAY 191          
The following BLAST results are available for this feature:
BLAST of CX294781 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
PSB5B_ARATH9.696e-8285.00Proteasome subunit beta type-5-B OS=Arabidopsis th... [more]
PSB5A_ARATH1.266e-8183.89Proteasome subunit beta type-5-A OS=Arabidopsis th... [more]
PSB5_SPIOL1.654e-8185.39Proteasome subunit beta type-5 OS=Spinacia olerace... [more]
PSB5_BOVIN1.669e-4959.88Proteasome subunit beta type-5 OS=Bos taurus GN=PS... [more]
PSB5_RAT6.343e-4963.16Proteasome subunit beta type-5 OS=Rattus norvegicu... [more]
PSB5_MOUSE6.343e-4960.61Proteasome subunit beta type-5 OS=Mus musculus GN=... [more]
PSB5_PONAB1.082e-4872.58Proteasome subunit beta type-5 OS=Pongo abelii GN=... [more]
PSB5_HUMAN1.082e-4872.58Proteasome subunit beta type-5 OS=Homo sapiens GN=... [more]
PSB5_DICDI1.013e-4655.62Proteasome subunit beta type-5 OS=Dictyostelium di... [more]
PSB5_CHICK3.258e-4564.96Proteasome subunit beta type-5 (Fragment) OS=Gallu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05055H03SK FlavSen1 Citrus clementina cDNA clone C05055H03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294781 ID=CX294781|Name=CX294781|organism=Citrus clementina|type=EST|length=629bp
TTTCTGCTCGCAACTCTTAGCTACATTGTCGTTTAATCTTAAATTCAGTG
CGTAGACATGAAGCTCGACACTAGCGGTCTTGAGTCCACTTCTCCATTTT
TCGGGTCAGGCGACGAGCTCTGTCCTGAGTTATCAGCTGCACCATCATTT
GCTCTACCTCTTTCTACTGATTTTGATGAATTTCAAAAGGACACTAAAGC
TACACTGAAGCATGCCAAGGGGACAACCACACTTGCTTTTATCTTTAAAG
AGGGTGTTATGGTGGCTGCTGATTCTCGAGCTAGCATGGGAGGCTATATC
TCATCACAGTCTGTGAAGAAAATTATAGAAATCAATCCTTACATGCTTGG
CACAATGGCTGGAGGAGCAGCCGATTGCCAGTTTTGGCACAGAAATCTGG
GCATTAAGTGCCGACTACATGAATTGGCCAACAAGCGTAGAATTTCAGTT
ACAGGGGCATCAAAGCTGCTGGCCAACATTCTCTACTCTTATCGTGGAAT
GGGGTTGTCTGTTGGGACTATGATTGCTGGATGGGATGAGACTGGTCCTG
GGCTGTATTATGTGGACAGTGAAGGAGGGAGGCTCAAAGGACACGGTTCT
CTGTGGATCAGGTTCACATATGCTTATGG
back to top