CX294784

Overview
NameCX294784
Unique NameCX294784
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length511
Libraries
Library NameType
FlavSen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX294784_ssr447 microsatellite CX294784_ssr447:447..458. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CX294784 vs. ExPASy Swiss-Prot
Match: ALA2_PANMI (Alanine aminotransferase 2 OS=Panicum miliaceum PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 6.921e-33
Identity = 66/84 (78.57%), Postives = 74/84 (88.10%), Query Frame = 1
Query:  259 QVLKCEYAVRGEIVTIAQRLQQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFFREVLALCDHPSILDRSETQGLFSADSIER 510
            +VLKCEYAVRGEIV  AQ LQQ+LQT PGS  FDEILYCNIGNPQSLGQQP+TFFREVLALCDHP +L++ ET+ LFSAD+I R
Sbjct:   13 KVLKCEYAVRGEIVIHAQHLQQQLQTQPGSLPFDEILYCNIGNPQSLGQQPVTFFREVLALCDHPCLLEKEETKSLFSADAISR 96          
BLAST of CX294784 vs. ExPASy Swiss-Prot
Match: ALA2_HORVU (Alanine aminotransferase 2 OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 2.630e-32
Identity = 66/84 (78.57%), Postives = 73/84 (86.90%), Query Frame = 1
Query:  259 QVLKCEYAVRGEIVTIAQRLQQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFFREVLALCDHPSILDRSETQGLFSADSIER 510
            +VLKCEYAVRGEIV  AQRLQ++L+T PGS  FDEILYCNIGNPQSLGQQP+TFFREVLALCDHP +L R E + LFSADSI R
Sbjct:   13 KVLKCEYAVRGEIVIHAQRLQEQLKTQPGSLPFDEILYCNIGNPQSLGQQPVTFFREVLALCDHPDLLQREEIKTLFSADSISR 96          
BLAST of CX294784 vs. ExPASy Swiss-Prot
Match: ALAT_SCHPO (Putative alanine aminotransferase OS=Schizosaccharomyces pombe GN=SPBC582.08 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.955e-19
Identity = 44/87 (50.57%), Postives = 59/87 (67.82%), Query Frame = 1
Query:  259 QVLKCEYAVRGEIVTIAQRLQQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFFREVLALCDHPSILDRSET---QGLFSADSIER 510
            QV K  YAVRG +  +A  +Q +L  NP S+ F EI+Y NIGNPQ +GQ PITF R+VL+LC +P++LD +E    Q LF  D ++R
Sbjct:   36 QVFKANYAVRGALAILADEIQDDLLENPSSYPFSEIVYANIGNPQQMGQSPITFVRQVLSLCQYPTLLDHAEEKWFQNLFPTDVVQR 122          
BLAST of CX294784 vs. ExPASy Swiss-Prot
Match: ALAT_YEAST (Probable alanine aminotransferase OS=Saccharomyces cerevisiae GN=ALT2 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.921e-15
Identity = 43/87 (49.43%), Postives = 58/87 (66.67%), Query Frame = 1
Query:  262 VLKCEYAVRGEIVTIAQRLQQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFFREVLALCDHPSIL----DRSETQGLFSADSIER 510
            V K EYAVRG I T A  L++EL+ NP    FD+I+  NIGNPQ L Q+P+TF R+VLA+ ++P IL    +   +  LFS D++ER
Sbjct:   35 VTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALER 121          
BLAST of CX294784 vs. ExPASy Swiss-Prot
Match: ALAM_YEAST (Probable alanine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae GN=ALT1 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.450e-14
Identity = 40/87 (45.98%), Postives = 60/87 (68.97%), Query Frame = 1
Query:  262 VLKCEYAVRGEIVTIAQRLQQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFFREVLALCDHPSILDRSETQ----GLFSADSIER 510
            VLK +YAVRG I   A+ L+ +L+ +P S  FD I+  NIGNPQ L Q+P+T++R+VL+L  +P +L+++E Q     LF  D+I+R
Sbjct:  120 VLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKR 206          
BLAST of CX294784 vs. ExPASy Swiss-Prot
Match: ALAM_DICDI (Probable alanine aminotransferase, mitochondrial OS=Dictyostelium discoideum GN=gpt PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 9.398e-14
Identity = 37/87 (42.53%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  262 VLKCEYAVRGEIVTIAQRLQQELQTNPGSHS----FDEILYCNIGNPQSLGQQPITFFREVLALCDHPSILDRSETQGLFSADSIER 510
            V   +YAVRGE+V  A+ +  +LQ      +    F+EI+YCNIGNPQ L Q+P+T+FR+V++L + P +LD    + ++ AD I R
Sbjct:   63 VRNAQYAVRGELVIRAEAISHQLQKQKTEGTKTLPFEEIVYCNIGNPQQLKQKPLTYFRQVVSLVECPDLLDNPYVEKIYPADVISR 149          
BLAST of CX294784 vs. ExPASy Swiss-Prot
Match: ALAT2_DANRE (Alanine aminotransferase 2-like OS=Danio rerio GN=gpt2l PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 1.500e-11
Identity = 33/68 (48.53%), Postives = 49/68 (72.06%), Query Frame = 1
Query:  262 VLKCEYAVRGEIVTIAQRLQQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFFREVLALCDHPSILD 465
            V K +YAVRG IV  A ++++EL+       FDE++  NIG+  ++GQ+PITFFR+V+ALC +P +LD
Sbjct:   83 VKKVDYAVRGPIVQRAVQIEKELKEGV-KKPFDEVIKANIGDAHAMGQRPITFFRQVMALCTYPQLLD 149          
BLAST of CX294784 vs. ExPASy Swiss-Prot
Match: ALAT2_HUMAN (Alanine aminotransferase 2 OS=Homo sapiens GN=GPT2 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.559e-11
Identity = 35/69 (50.72%), Postives = 47/69 (68.12%), Query Frame = 1
Query:  259 QVLKCEYAVRGEIVTIAQRLQQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFFREVLALCDHPSILD 465
            QV   EYAVRG IV  A  ++ ELQ       F E++  NIG+ Q++GQQPITF R+V+ALC +P++LD
Sbjct:   56 QVKAVEYAVRGPIVLKAGEIELELQRGI-KKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLD 123          
BLAST of CX294784 vs. ExPASy Swiss-Prot
Match: ALAT1_RAT (Alanine aminotransferase 1 OS=Rattus norvegicus GN=Gpt PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 2.559e-11
Identity = 35/67 (52.24%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  262 VLKCEYAVRGEIVTIAQRLQQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFFREVLALCDHPSIL 462
            V + EYAVRG IV  A  L+QEL+       F E++  NIG+ Q++GQ+PITFFR+VLALC +P++L
Sbjct:   30 VRRVEYAVRGPIVQRALELEQELRQGV-KKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLL 95          
BLAST of CX294784 vs. ExPASy Swiss-Prot
Match: ALAT1_MOUSE (Alanine aminotransferase 1 OS=Mus musculus GN=Gpt PE=2 SV=3)

HSP 1 Score: 68.1662 bits (165), Expect = 2.559e-11
Identity = 35/67 (52.24%), Postives = 48/67 (71.64%), Query Frame = 1
Query:  262 VLKCEYAVRGEIVTIAQRLQQELQTNPGSHSFDEILYCNIGNPQSLGQQPITFFREVLALCDHPSIL 462
            V + EYAVRG IV  A  L+QEL+       F E++  NIG+ Q++GQ+PITFFR+VLALC +P++L
Sbjct:   30 VRRVEYAVRGPIVQRALELEQELRQGV-KKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLL 95          
The following BLAST results are available for this feature:
BLAST of CX294784 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
ALA2_PANMI6.921e-3378.57Alanine aminotransferase 2 OS=Panicum miliaceum PE... [more]
ALA2_HORVU2.630e-3278.57Alanine aminotransferase 2 OS=Hordeum vulgare PE=2... [more]
ALAT_SCHPO1.955e-1950.57Putative alanine aminotransferase OS=Schizosacchar... [more]
ALAT_YEAST2.921e-1549.43Probable alanine aminotransferase OS=Saccharomyces... [more]
ALAM_YEAST1.450e-1445.98Probable alanine aminotransferase, mitochondrial O... [more]
ALAM_DICDI9.398e-1442.53Probable alanine aminotransferase, mitochondrial O... [more]
ALAT2_DANRE1.500e-1148.53Alanine aminotransferase 2-like OS=Danio rerio GN=... [more]
ALAT2_HUMAN2.559e-1150.72Alanine aminotransferase 2 OS=Homo sapiens GN=GPT2... [more]
ALAT1_RAT2.559e-1152.24Alanine aminotransferase 1 OS=Rattus norvegicus GN... [more]
ALAT1_MOUSE2.559e-1152.24Alanine aminotransferase 1 OS=Mus musculus GN=Gpt ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05055H08SK FlavSen1 Citrus clementina cDNA clone C05055H08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294784 ID=CX294784|Name=CX294784|organism=Citrus clementina|type=EST|length=511bp
GCTGAATTACTTTAAGAGATTTTTTGAACTTAACGATAAACTAAGTTTTG
ACTGAAATTGTAGGATAGTTGTTTTAAGTTATTTTATCGTAAGTTCTACT
GAATTTTGTATAGTGAGTCATTGTGATTATAGAGTACTGATGAAAGACAA
TGTGTTACCCTTTTGTTCTGATTCTCATTGTTAAGTTTTCTTGATTGCGT
GGTTGTTGTAAGTTTTTTCTGTTCTTGATTTGATCCCTCACGAAGTTTCT
CTTCCCTTCAGGTTCTAAAATGCGAGTATGCTGTTCGTGGTGAGATTGTC
ACCATTGCCCAGCGGTTGCAACAAGAGTTACAAACTAACCCTGGCTCTCA
TTCCTTTGATGAGATACTGTACTGCAACATTGGAAATCCTCAGTCTCTTG
GTCAGCAGCCAATAACCTTTTTCCGAGAGGTTCTTGCATTATGTGACCAT
CCATCCATTTTGGACAGAAGTGAAACACAAGGTTTGTTCAGTGCGGATTC
TATAGAGCGAG
back to top