CX294785

Overview
NameCX294785
Unique NameCX294785
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length506
Libraries
Library NameType
FlavSen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX294785 vs. ExPASy Swiss-Prot
Match: C16B2_PICSI (Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP716B2 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.083e-17
Identity = 52/173 (30.06%), Postives = 95/173 (54.91%), Query Frame = 3
Query:    6 GQDSLSLYRSTKILTFTIVFECLLGIRVEPGMLNT---FERVLEGVFAPAIKFPGSRFSRAKKARQEIEKMLVKVVREKRNEMEFGNEQ-EGMLLSQLVAGMIRG--DITEAEVTDNVVLLVFAAHDTTSFAIAMTFKMLAQHPDCYSLLLHEHVNIMNNKRAAEILTLEDMK 506
            G+D ++     K  TF++  +    I  +  +      F   ++GV    I  PG+R+++AK A   I + L  ++ E++  +E GN   E  LLS L++ +      +T+ E+ DN++LL++A HDT+S  + +  K LA++P CY  +L E ++I  +K A ++L  ED++
Sbjct:  181 GKDEVTALPLLKRYTFSLACDLFASINNKDDLGRLWLHFMVFVKGVMQIPIDLPGTRYNKAKHAANAIRQQLGSIINERKIGLEAGNASPEQDLLSFLLSNVDEQGESLTDNEIQDNILLLLYAGHDTSSSTLTVLLKFLAENPHCYEEVLREQLDIAGSKEAGQLLEWEDLQ 353          
BLAST of CX294785 vs. ExPASy Swiss-Prot
Match: C16B1_PICSI (Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 5.258e-17
Identity = 51/173 (29.48%), Postives = 92/173 (53.18%), Query Frame = 3
Query:    6 GQDSLSLYRSTKILTFTIVFECLLGIRVEPGMLNT---FERVLEGVFAPAIKFPGSRFSRAKKARQEIEKMLVKVVREKRNEMEFGNEQ-EGMLLSQLVAGMIRG--DITEAEVTDNVVLLVFAAHDTTSFAIAMTFKMLAQHPDCYSLLLHEHVNIMNNKRAAEILTLEDMK 506
            G+D +      K  TF++  +    I  +  +      F   ++GV    I  PG+R+++ K A   I + L  ++ E++  +E GN   E  LLS L++ +      +T+ E+ DN++LL++A HDT+S  + +  K LA++P CY  +L E +NI  +K   ++L  ED++
Sbjct:  181 GKDEVMALPLLKRYTFSLACDLFASINTKDDLDRLWLHFMVFVKGVMQIPIDLPGTRYNKTKHAANAIRQQLGSIINERKIALEAGNASPEQDLLSFLLSNVDEQGESLTDNEIQDNILLLLYAGHDTSSSTLTVLLKFLAENPHCYEEVLREQLNIAGSKEEGQLLEWEDLQ 353          
BLAST of CX294785 vs. ExPASy Swiss-Prot
Match: T5H_TAXCU (Taxadiene 5-alpha hydroxylase OS=Taxus cuspidata PE=1 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 7.593e-16
Identity = 50/175 (28.57%), Postives = 98/175 (56.00%), Query Frame = 3
Query:    6 GQDSLSLYRSTKILTFTI---VFECLLGIRVEPGMLNTFERVLEGVFAPAIKFPGSRFSRAKKARQEIEKMLVKVVREKRNEMEFGNEQEGM-LLSQLVAGMIRGD----ITEAEVTDNVVLLVFAAHDTTSFAIAMTFKMLAQHPDCYSLLLHEHVNIMNNKRAAEILTLEDMK 506
            G+D +++    + L F I   +F  +   + +  +    E +L G FA  I  PG  F RA + R ++ K+++ ++++++ +++ G+      LLS L+    R D    +T  E+ DN   L+ A++DTT+  +A+ FK+L+ +P+CY  ++ E + I++NK   E +T +D+K
Sbjct:  183 GKDEVNVLPLVRELVFNISAILFFNIYDKQEQDRLHKLLETILVGSFALPIDLPGFGFHRALQGRAKLNKIMLSLIKKRKEDLQSGSATATQDLLSVLLT--FRDDKGTPLTNDEILDNFSSLLHASYDTTTSPMALIFKLLSSNPECYQKVVQEQLEILSNKEEGEEITWKDLK 355          
BLAST of CX294785 vs. ExPASy Swiss-Prot
Match: T13H_TAXCU (Taxane 13-alpha-hydroxylase OS=Taxus cuspidata GN=CYP725A2 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.190e-14
Identity = 47/173 (27.17%), Postives = 89/173 (51.45%), Query Frame = 3
Query:    6 GQDSLSLYRSTKILTFTIVFECLLGI---RVEPGMLNTFERVLEGVFAPAIKFPGSRFSRAKKARQEIEKMLVKVVREKRNEMEFGNEQEGM-LLSQLVAGMI-RGD-ITEAEVTDNVVLLVFAAHDTTSFAIAMTFKMLAQHPDCYSLLLHEHVNIMNNKRAAEILTLEDMK 506
            G+D  ++    K L F++      GI    ++  + N  E +L G F+  +  PG  + +A +AR  +  ++  ++ ++RNE+  G   E   LLS L+     RG+ + + E+ DN  +L+  ++D+T+  + M  K+LA HP+ Y  +  E   I++ K   E +  +D+K
Sbjct:  169 GKDEATVLPLVKDLVFSVASRLFFGITEEHLQEQLHNLLEVILVGSFSVPLNIPGFSYHKAIQARATLADIMTHLIEKRRNELRAGTASENQDLLSVLLTFTDERGNSLADKEILDNFSMLLHGSYDSTNSPLTMLIKVLASHPESYEKVAQEQFGILSTKMEGEEIAWKDLK 341          
BLAST of CX294785 vs. ExPASy Swiss-Prot
Match: ABAH3_ARATH (Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.026e-12
Identity = 42/166 (25.30%), Postives = 80/166 (48.19%), Query Frame = 3
Query:   18 LSLYRSTKILTFTIVFECLLG---IRVEPGMLNTFERVLEGVFAPAIKFPGSRFSRAKKARQEIEKMLVKVVREKRNEMEFGNEQEGMLLSQLVAGMIRGDITEAEVTDNVVLLVFAAHDTTSFAIAMTFKMLAQHPDCYSLLLHEHVNIMNNKRAAEILTLEDMK 506
            L+ Y+  K  TF +    +LG   +     +   +  + +G  +  I  PG+ F +A KAR+E+ ++L  ++ ++R       +  G  +        +  +T+ ++ DN++ ++FAA DTT+  +    K LA +P     +  E + I  +K+  E LT ED K
Sbjct:  165 LNTYQEMKTYTFNVALISILGKDEVYYREDLKRCYYILEKGYNSMPINLPGTLFHKAMKARKELAQILANILSKRRQNPSSHTDLLGSFMED------KAGLTDEQIADNIIGVIFAARDTTASVLTWILKYLADNPTVLEAVTEEQMAIRKDKKEGESLTWEDTK 324          
BLAST of CX294785 vs. ExPASy Swiss-Prot
Match: ABAH1_ARATH (Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.750e-12
Identity = 39/166 (23.49%), Postives = 83/166 (50.00%), Query Frame = 3
Query:   18 LSLYRSTKILTFTIVFECLLG---IRVEPGMLNTFERVLEGVFAPAIKFPGSRFSRAKKARQEIEKMLVKVVREKRNEMEFGNEQEGMLLSQLVAGMIRGDITEAEVTDNVVLLVFAAHDTTSFAIAMTFKMLAQHPDCYSLLLHEHVNIMNNKRAAEILTLEDMK 506
            ++ Y+  K  TF +    + G   +     +   +  + +G  +  +  PG+ F ++ KAR+E+ ++L +++ E+R      N+  G  +        + ++T+ ++ DN++ ++FAA DTT+  ++   K LA++P+    +  E + I  +K   E LT  D K
Sbjct:  165 INTYQEMKTYTFNVALLSIFGKDEVLYREDLKRCYYILEKGYNSMPVNLPGTLFHKSMKARKELSQILARILSERRQNGSSHNDLLGSFMGD------KEELTDEQIADNIIGVIFAARDTTASVMSWILKYLAENPNVLEAVTEEQMAIRKDKEEGESLTWGDTK 324          
BLAST of CX294785 vs. ExPASy Swiss-Prot
Match: T10H_TAXCU (Taxane 10-beta-hydroxylase OS=Taxus cuspidata GN=CYP725A1 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.528e-11
Identity = 39/173 (22.54%), Postives = 92/173 (53.18%), Query Frame = 3
Query:    6 GQDSLSLYRSTKILTFTIVFECLLGIR---VEPGMLNTFERVLEGVFAPAIKFPGSRFSRAKKARQEIEKMLVKVVREKRNEMEFG--NEQEGMLLSQLVAGMIRGD-ITEAEVTDNVVLLVFAAHDTTSFAIAMTFKMLAQHPDCYSLLLHEHVNIMNNKRAAEILTLEDMK 506
            G+D + +    + L F+I       +     +  + +  E +L G  +  + FPG+R+ +  +AR +++++L  +++ +R ++  G  ++ + +L   L     +G+ +T+  + DN   +  A++DTT   +A+ FK+L  +P+ +  +  E + I+ NK+  E ++ +D+K
Sbjct:  181 GKDEVKVLPLVRGLIFSIASTLFFDVNDGHQQKQLHHLLETILVGSLSVPLDFPGTRYRKGLQARLKLDEILSSLIKRRRRDLRSGIASDDQDLLSVLLTFRDEKGNSLTDQGILDNFSAMFHASYDTTVAPMALIFKLLYSNPEYHEKVFQEQLEIIGNKKEGEEISWKDLK 353          
BLAST of CX294785 vs. ExPASy Swiss-Prot
Match: C85A2_ARATH (Cytochrome P450 85A2 OS=Arabidopsis thaliana GN=CYP85A2 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.301e-11
Identity = 37/132 (28.03%), Postives = 69/132 (52.27%), Query Frame = 3
Query:  111 FERVLEGVFAPAIKFPGSRFSRAKKARQEIEKMLVKVVREKRNEMEFGNEQEGMLLSQLVAGMIRGDITEAEVTDNVVLLVFAAHDTTSFAIAMTFKMLAQHPDCYSLLLHEHVNIMNNKRAAEILTLEDMK 506
            F +++ G  +  I  PG+ +    +AR  I+++L ++++E++   E   +  G L+ +     +   +T+ E+ D VV ++++ ++T S    M  K L  HP     L  EH+ I   KR  E LTL+D+K
Sbjct:  198 FFKLVVGTLSVPIDIPGTNYRSGVQARNNIDRLLTELMQERKESGETFTDMLGYLMKKEDNRYL---LTDKEIRDQVVTILYSGYETVSTTSMMALKYLHDHPKALEELRREHLAIRERKRPDEPLTLDDIK 326          
The following BLAST results are available for this feature:
BLAST of CX294785 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
C16B2_PICSI3.083e-1730.06Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP71... [more]
C16B1_PICSI5.258e-1729.48Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP71... [more]
T5H_TAXCU7.593e-1628.57Taxadiene 5-alpha hydroxylase OS=Taxus cuspidata P... [more]
T13H_TAXCU3.190e-1427.17Taxane 13-alpha-hydroxylase OS=Taxus cuspidata GN=... [more]
ABAH3_ARATH1.026e-1225.30Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thal... [more]
ABAH1_ARATH1.750e-1223.49Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thal... [more]
T10H_TAXCU2.528e-1122.54Taxane 10-beta-hydroxylase OS=Taxus cuspidata GN=C... [more]
C85A2_ARATH3.301e-1128.03Cytochrome P450 85A2 OS=Arabidopsis thaliana GN=CY... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05055H09SK FlavSen1 Citrus clementina cDNA clone C05055H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294785 ID=CX294785|Name=CX294785|organism=Citrus clementina|type=EST|length=506bp
GGCATGGCCAAGACAGCCTTAGCCTTTATCGTTCGACGAAGATTTTGACA
TTCACCATAGTGTTCGAGTGTCTATTAGGCATCAGAGTTGAGCCTGGGAT
GTTGAACACCTTTGAGAGAGTTTTAGAAGGTGTTTTTGCTCCGGCAATTA
AGTTTCCAGGATCAAGATTCTCGCGAGCAAAGAAAGCAAGGCAAGAGATA
GAAAAGATGTTGGTAAAAGTTGTGAGAGAAAAGAGAAATGAGATGGAATT
TGGAAATGAACAAGAAGGGATGTTATTGTCGCAACTGGTTGCTGGGATGA
TTCGAGGAGACATTACAGAGGCAGAGGTTACTGATAACGTTGTCTTGCTC
GTCTTTGCAGCGCATGATACCACATCTTTTGCCATTGCCATGACGTTTAA
GATGCTAGCGCAGCATCCAGATTGCTATTCTCTCCTCCTACATGAACATG
TTAACATAATGAATAATAAAAGAGCTGCCGAAATTCTAACACTGGAAGAC
ATGAAG
back to top