CX294789

Overview
NameCX294789
Unique NameCX294789
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length645
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX294789_ssr46 microsatellite CX294789_ssr46:46..60. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig576 contig Ccv1_Contig576:1..646. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX294789 vs. ExPASy Swiss-Prot
Match: TRAD1_MACFA (TRAF-type zinc finger domain-containing protein 1 OS=Macaca fascicularis GN=TRAFD1 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.850e-23
Identity = 44/130 (33.85%), Postives = 71/130 (54.62%), Query Frame = 1
Query:  202 DETTKICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAPVACSQCSETMEREILAIHKGEKCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHESRC 591
            D+ T++C +C + IP  N  +H  HC RN+  C +C +  P+   E H    H  V C +C++ +E+ +L  H+  +CP R+  C  C+  L  + L EH++ CG RTELC  C R + +++   H   C
Sbjct:    7 DQETRLCDNCKKEIPVFNFTIHEIHCQRNIGMCPICKEPFPKSDMETHMAAEHCQVTC-KCNKKLEKRLLKKHEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGNCGRNVLVKDLKTHPEVC 135          
BLAST of CX294789 vs. ExPASy Swiss-Prot
Match: TRAD1_RAT (TRAF-type zinc finger domain-containing protein 1 OS=Rattus norvegicus GN=Trafd1 PE=2 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 6.348e-23
Identity = 47/135 (34.81%), Postives = 71/135 (52.59%), Query Frame = 1
Query:  202 DETTKICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAPVACSQCSETMEREILAIHKGEKCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHESRCTGVPE 606
            D+  ++C +C + IP  N  +H  HC RN+  C VC +  P+   + H    H  V C +C++ +E+  L  H   +CP R+  C  C+  L  V L EH++ CG RTELC  C R + ++E   H + C  V E
Sbjct:    7 DQAARLCDNCKKEIPVFNFTIHEIHCQRNIGVCPVCKEPFPKSDMDIHVATEHCQVTC-KCNKKLEKRQLKQHVETECPLRLAVCQHCDLELSVVKLKEHEDYCGARTELCGSCGRNVLVKELQTHPAVCGRVEE 140          
BLAST of CX294789 vs. ExPASy Swiss-Prot
Match: TRAD1_HUMAN (TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens GN=TRAFD1 PE=1 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 6.348e-23
Identity = 44/130 (33.85%), Postives = 70/130 (53.85%), Query Frame = 1
Query:  202 DETTKICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAPVACSQCSETMEREILAIHKGEKCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHESRC 591
            D+ T++C +C + IP  N  +H  HC RN+  C  C +  P+   E H    H  V C +C++ +E+ +L  H+  +CP R+  C  C+  L  + L EH++ CG RTELC  C R + +++   H   C
Sbjct:    7 DQETRLCDNCKKEIPVFNFTIHEIHCQRNIGMCPTCKEPFPKSDMETHMAAEHCQVTC-KCNKKLEKRLLKKHEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGNCGRNVLVKDLKTHPEVC 135          
BLAST of CX294789 vs. ExPASy Swiss-Prot
Match: TRAD1_MOUSE (TRAF-type zinc finger domain-containing protein 1 OS=Mus musculus GN=Trafd1 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 8.291e-23
Identity = 47/135 (34.81%), Postives = 71/135 (52.59%), Query Frame = 1
Query:  202 DETTKICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAPVACSQCSETMEREILAIHKGEKCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHESRCTGVPE 606
            D+ +++C +C + IP  N  +H  HC RN+  C VC +  P+   + H    H  V C +C++ +E+  L  H   +CP R+  C  C+  L  V L EH++ CG RTELC  C R + ++E   H   C  V E
Sbjct:    7 DQASRLCDNCKKEIPVFNFTIHEIHCQRNIGVCPVCKEPFPKSDMDIHMAAEHCQVTC-KCNKKLEKRQLKQHAETECPLRLAVCQHCDLELSVVKLKEHEDYCGARTELCGSCGRNVLVKELKTHPEVCGRVEE 140          
BLAST of CX294789 vs. ExPASy Swiss-Prot
Match: TRAD1_BOVIN (TRAF-type zinc finger domain-containing protein 1 OS=Bos taurus GN=TRAFD1 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.847e-22
Identity = 44/131 (33.59%), Postives = 71/131 (54.20%), Query Frame = 1
Query:  199 SDETTKICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAPVACSQCSETMEREILAIHKGEKCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHESRC 591
            +D+ T++C +C + IP  N  +H  HC RN+  C VC +  P+   E H    H  V C +C++ +E+  L  H+  +CP R+  C  C+  L  + L +H++ CG RTELC  C R + +++   H   C
Sbjct:    6 NDQDTRLCDNCKKEIPVFNFTIHEIHCQRNIGVCPVCKEPFPKCDMETHMATEHCQVTC-KCNKKLEKRQLKKHEETECPLRLALCQHCDLELSVLKLKDHEDYCGARTELCGTCGRNVLVKDLKTHPEVC 135          
BLAST of CX294789 vs. ExPASy Swiss-Prot
Match: XAF1_HUMAN (XIAP-associated factor 1 OS=Homo sapiens GN=XAF1 PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 7.019e-22
Identity = 46/125 (36.80%), Postives = 67/125 (53.60%), Query Frame = 1
Query:  217 ICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAPVACSQCSETMEREILAIHKGEKCPQRIVTCDFCEFPLPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHESRC 591
            +C +C R + S+N  LH A+C R L  C  C + VP++  EEH    H  V C+ C ++M++  L  HK  +C +R V C FC+  +    L  H+  CG+RTELC  C ++I  R    H   C
Sbjct:    7 VCRNCKRHVVSANFTLHEAYCLRFLVLCPECEEPVPKETMEEHCKLEHQQVGCTMCQQSMQKSSLEFHKANECQERPVECKFCKLDMQLSKLELHESYCGSRTELCQGCGQFIMHRMLAQHRDVC 131          
BLAST of CX294789 vs. ExPASy Swiss-Prot
Match: XAF1_BOVIN (XIAP-associated factor 1 OS=Bos taurus GN=XAF1 PE=2 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 5.561e-19
Identity = 45/128 (35.16%), Postives = 68/128 (53.12%), Query Frame = 1
Query:  214 KICSHCDRAIPSSNIDLHFAHCSRNLERCKVCGDMVPRKYAEEHFLNTHAPVACSQCSETMEREILAIHKGEKCPQRIVTCDFCEFP--LPAVDLAEHQEVCGNRTELCHLCNRYIRLRERYNHESRC 591
            ++C +C R + S+++ LH AHC   L  C  C + V +   EEH    H  V C+ C +++ +  L  H+ ++C +R V C FC+    L  VDL EH   CG +TELC  C +++ LR    H   C
Sbjct:    6 QVCRNCKRRVASNHLGLHEAHCLMYLVLCPECKEPVLQHEMEEHCQGGHQQVGCAMCQQSVPKHSLDSHEAQECQERPVECQFCQLAVRLNKVDLHEHH--CGQQTELCPDCGQHVMLRVLARHREEC 131          
The following BLAST results are available for this feature:
BLAST of CX294789 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
TRAD1_MACFA2.850e-2333.85TRAF-type zinc finger domain-containing protein 1 ... [more]
TRAD1_RAT6.348e-2334.81TRAF-type zinc finger domain-containing protein 1 ... [more]
TRAD1_HUMAN6.348e-2333.85TRAF-type zinc finger domain-containing protein 1 ... [more]
TRAD1_MOUSE8.291e-2334.81TRAF-type zinc finger domain-containing protein 1 ... [more]
TRAD1_BOVIN1.847e-2233.59TRAF-type zinc finger domain-containing protein 1 ... [more]
XAF1_HUMAN7.019e-2236.80XIAP-associated factor 1 OS=Homo sapiens GN=XAF1 P... [more]
XAF1_BOVIN5.561e-1935.16XIAP-associated factor 1 OS=Bos taurus GN=XAF1 PE=... [more]
back to top
Libraries
Library NameType
PhIFruit1cdna_library
Properties
Property NameValue
Genbank descriptionC05056A01SK PhIFruit1 Citrus clementina cDNA clone C05056A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294789 ID=CX294789|Name=CX294789|organism=Citrus clementina|type=EST|length=645bp
ACACGAAGCCTCCCTTCCCAATTTAAAGAAAAAAAAAATTATTTCTTATT
TTATTTTATTTTCCCCCTAATTTTCTGAGAAATCCATAAAACAGCATCTA
GCGAGAACAAGACTGCGACATCACACAAACTTCTTCTATCTCTCCCTAAA
AAGAGCTACGACGTCGAATTGATTGATCGTATCGCGATGGCAATGACTTC
TGATGAAACCACAAAAATATGCAGTCACTGTGACAGAGCTATACCGTCTT
CAAATATTGATTTGCATTTTGCACATTGCTCGCGGAATCTGGAACGATGT
AAAGTATGTGGTGACATGGTTCCAAGGAAATATGCTGAGGAGCACTTCTT
AAATACCCATGCCCCGGTGGCCTGTTCACAGTGCAGCGAGACAATGGAGC
GTGAAATTTTAGCCATCCATAAAGGTGAAAAGTGCCCGCAAAGGATTGTC
ACTTGCGACTTTTGTGAGTTTCCACTGCCTGCAGTTGATCTGGCCGAGCA
TCAGGAAGTCTGTGGGAATCGCACAGAACTTTGTCATCTGTGTAACAGAT
ATATTAGGTTGCGAGAAAGATATAACCATGAAAGTAGGTGCACAGGTGTC
CCAGAAACACTGTTGGATCTTCCAGGATGTAGGGCAGCTGAAGTG
back to top