CX294791

Overview
NameCX294791
Unique NameCX294791
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length614
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX294791 vs. ExPASy Swiss-Prot
Match: BI1L_ARATH (BI1-like protein OS=Arabidopsis thaliana GN=At4g15470 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.445e-18
Identity = 52/96 (54.17%), Postives = 64/96 (66.67%), Query Frame = 1
Query:   28 KMLGYETVR----SKDDGKFEVDLEGGDGER-LYPGLSYGENQLRWGFIRKVYGILTAQIVLTTLVSSITVLYNPINDXXXXXXXXXXXXXILPFI 300
            K  GY +V      +  GK ++DLE G GE  LYPGLSYGENQLRWGFIRKVYGIL+AQ++LTTL+S++ VL  P+ND             I+PFI
Sbjct:    3 KPYGYASVSMSGIDRSAGK-DIDLEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLTTLISAVVVLNPPVNDLLTGSPGILLFLCIVPFI 97          
The following BLAST results are available for this feature:
BLAST of CX294791 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
BI1L_ARATH1.445e-1854.17BI1-like protein OS=Arabidopsis thaliana GN=At4g15... [more]
back to top
Libraries
Library NameType
PhIFruit1cdna_library
Properties
Property NameValue
Genbank descriptionC05056A03SK PhIFruit1 Citrus clementina cDNA clone C05056A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294791 ID=CX294791|Name=CX294791|organism=Citrus clementina|type=EST|length=614bp
GAAAATTCAAAAATCAAAATCGCTTGAAAGATGTTGGGCTACGAGACGGT
GAGGAGCAAAGATGACGGCAAATTCGAGGTAGATCTGGAAGGCGGAGATG
GGGAGAGGCTTTACCCCGGTCTCAGCTACGGCGAGAACCAGCTCCGATGG
GGTTTCATTCGCAAGGTGTACGGCATCTTGACGGCCCAGATCGTTTTGAC
CACCTTGGTCTCCTCAATCACCGTTCTTTACAATCCCATCAACGATCTTC
TCAGGGGCAATTCTGGCCTTCTCCTCTTCCTCTCCATCCTCCCCTTCATC
CGTACGTTTCAGTTCGTTTAATTCCCTATATGAATTGGTTATCTTAGTAA
TTTCGTTAATTTGATATTTCGCTGAATTTTATGTTTGCTTATACTGAAAT
TAGGTAGGTATATACTTGGGAATGTTGTTAATTGACGATTACGATTAAGG
GTTTCTTTTGTTTGCTTTGTGTTGTCCTTAATGATTCTTCGTGCTGAGTT
TGCTTGGTTGGGGTTTTGATGGAATTGGTCATGTCATGCTTGAATCTTGA
GTATATGTTTAGTTGAATATGATTTGTTGCCTTCCATTATATGCGCTTGT
TCATTCTAATGGGA
back to top