CX294793

Overview
NameCX294793
Unique NameCX294793
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length641
Libraries
Library NameType
PhIFruit1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9348 contig Ccv1_Contig9348:148..789. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX294793 vs. ExPASy Swiss-Prot
Match: 12KD_FRAAN (Auxin-repressed 12.5 kDa protein OS=Fragaria ananassa PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.706e-18
Identity = 40/51 (78.43%), Postives = 46/51 (90.20%), Query Frame = 2
Query:  119 RKDNVWRSVFHPGSNLATRGIGAEVFDKPTHPNSPTVYDWLYSGETRSKHH 271
            RKDNVWRSVFHPGSNL+++ +G +VFD P  PNSPTVYDW+YSGETRSKHH
Sbjct:   61 RKDNVWRSVFHPGSNLSSKTMGNQVFDSP-QPNSPTVYDWMYSGETRSKHH 110          
The following BLAST results are available for this feature:
BLAST of CX294793 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
12KD_FRAAN2.706e-1878.43Auxin-repressed 12.5 kDa protein OS=Fragaria anana... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05056A05SK PhIFruit1 Citrus clementina cDNA clone C05056A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294793 ID=CX294793|Name=CX294793|organism=Citrus clementina|type=EST|length=641bp
AGTCAAAGAGGGTGGTGAGGCGGAGTCGTCGTCGGGCAAGTTCCAGAGGT
CTCTGTCAATGCCAGCGAGTCCAGGGGCACCGTCGACGCCAGTGACGCCG
ACGACGCCGCTGTCGGCGCGTAAGGACAACGTGTGGAGGAGCGTGTTTCA
CCCCGGTAGCAACCTTGCTACTAGGGGTATCGGTGCAGAGGTCTTTGACA
AGCCCACACATCCTAACTCTCCCACTGTTTATGACTGGCTTTACAGTGGG
GAGACTAGGAGCAAGCATCATCACTGAGTGGATGATACGCTCCAGCGATG
TAAATGAATGTGATGGGTCACCAACTCACCGGATGAGTTGCCTGTAGTCT
GTAGATAGTGTCGTTTCGTTTTGGATTTCGCAACGTGTCCTTGTCGTTTT
GTTAATGCTATTTGTATTACGTGTCCTTCCTATCTAAAGTTTGGTTTTAA
AATGCTGCTGACTAAAAGTAAACTAAAGACTGTGATGTTTTTATATCATA
TAATTTAATAATTGTATGTGATGTGAGGATTGCTAAGCTGTGGGCGGAGA
TGAAAGGTTGCTGGTTTTTGGGTTTAGGACATGTTTTTGATTGTCATTTT
GTAAGAGCCAGATCATCCCTTCGTGGACGGTCGTGATGAGC
back to top