CX294797

Overview
NameCX294797
Unique NameCX294797
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length641
Libraries
Library NameType
PhIFruit1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1029 contig Ccv1_Contig1029:26..666. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX294797 vs. ExPASy Swiss-Prot
Match: CLH1_CITUN (Chlorophyllase-1, chloroplastic OS=Citrus unshiu PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 2.681e-50
Identity = 115/210 (54.76%), Postives = 139/210 (66.19%), Query Frame = 3
Query:   18 MTAVADSKPV-SVEAKPGLATALLSVFSSGPYSPKLKTVNKPWFNSFPP-KPLNIVYPEEKGTYEVILFFHGTALSNTSYSNLLDHLASHGYIVVAPQLYDFL-PPKGNGEVNDAANVLNWLSTGLQSELPENVEANLNYVALMGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSHDSFEFSILLL*LGT 638
            M A+ DSKP  SV+  P LATA L VF+ G YS K  T+     +S PP KPL IV P EKGT+ VILF HGT+LSN SYS + DH+ASHG+IVVAPQLY  + PP    E+N AA V  WL  GLQ  LPEN EAN++ VA+MGHSRGG  AF L+L Y           A++G+DPVAG  S  + L+P ILS DSF+FSI +  +GT
Sbjct:    1 MAAMVDSKPAASVQGTPLLATATLPVFTRGIYSTKRITLETSSPSSPPPPKPLIIVTPAEKGTFNVILFLHGTSLSNKSYSKIFDHIASHGFIVVAPQLYTSIPPPSATNELNSAAEVAEWLPQGLQQNLPENTEANVSLVAVMGHSRGGQTAFALSLRYG--------FGAVIGLDPVAG-TSKTTGLDPSILSFDSFDFSIPVTVIGT 201          
BLAST of CX294797 vs. ExPASy Swiss-Prot
Match: CLH1_CITSI (Chlorophyllase-1, chloroplastic OS=Citrus sinensis GN=CHLASE1 PE=1 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 3.872e-49
Identity = 113/210 (53.81%), Postives = 138/210 (65.71%), Query Frame = 3
Query:   18 MTAVADSKPV-SVEAKPGLATALLSVFSSGPYSPKLKTVNKPWFNSFPP-KPLNIVYPEEKGTYEVILFFHGTALSNTSYSNLLDHLASHGYIVVAPQLYDFL-PPKGNGEVNDAANVLNWLSTGLQSELPENVEANLNYVALMGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSHDSFEFSILLL*LGT 638
            M A+ D+KP  SV+  P LATA L VF+ G YS K  T+     +S PP KPL IV P  KGT+ VILF HGT+LSN SYS + DH+ASHG+IVVAPQLY  + PP    E+N AA V  WL  GLQ  LPEN EAN++ VA+MGHSRGG  AF L+L Y           A++G+DPVAG  S  + L+P ILS DSF+FSI +  +GT
Sbjct:    1 MAAMVDAKPAASVQGTPLLATATLPVFTRGIYSTKRITLETSSPSSPPPPKPLIIVTPAGKGTFNVILFLHGTSLSNKSYSKIFDHIASHGFIVVAPQLYTSIPPPSATNELNSAAEVAEWLPQGLQQNLPENTEANVSLVAVMGHSRGGQTAFALSLRYG--------FGAVIGLDPVAG-TSKTTGLDPSILSFDSFDFSIPVTVIGT 201          
BLAST of CX294797 vs. ExPASy Swiss-Prot
Match: CLH1_ARATH (Chlorophyllase-1 OS=Arabidopsis thaliana GN=CLH1 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.781e-39
Identity = 85/163 (52.15%), Postives = 111/163 (68.10%), Query Frame = 3
Query:  156 PPKPLNIVYPEEKGTYEVILFFHGTALSNTSYSNLLDHLASHGYIVVAPQLYDFLPPKGNGEVNDAANVLNWLSTGLQSELPENVEANLNYVALMGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSH--DSFEFSILLL*LGT 638
            PPKP+ I  P   GTY V+LFFHG  L N  YS++L+H+ASHGYI+VAPQL   LPP G  EV+DA +V+NW S  L++ LP +V AN  Y +L+GHSRGG  AF +ALG+A     SI  SAL+GIDPVAG  + +   +P IL++  +SFE  I +  +GT
Sbjct:   41 PPKPVRITCPTVAGTYPVVLFFHGFYLRNYFYSDVLNHIASHGYILVAPQLCKLLPPGGQVEVDDAGSVINWASENLKAHLPTSVNANGKYTSLVGHSRGGKTAFAVALGHAATLDPSITFSALIGIDPVAG-TNKYIRTDPHILTYKPESFELDIPVAVVGT 202          
BLAST of CX294797 vs. ExPASy Swiss-Prot
Match: CLH0_CHEAL (Chlorophyllase type 0 OS=Chenopodium album GN=CACLH PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.082e-30
Identity = 79/194 (40.72%), Postives = 113/194 (58.25%), Query Frame = 3
Query:   81 LLSVFSSGPYSPKLKTVNKPWFNSFPPKPLNIVYPEEKGTYEVILFFHGTALSNTSYSNLLDHLASHGYIVVAPQLYDFLPPK---GNGEVNDAANVLNWLSTGLQSELPE---NVEANLNYVALMGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSH--DSFEFSILLL*LGT 638
            +  VF  G +      +    +    P+PL I+ P+E G Y V+LF HGT LSN  YS   +++ASHG+IVVAP+L+   PPK      E++ AA+V NW+   LQ  L      VE +L  +A+ GHSRGG  AF LALG+ +N  + +  SAL+G+DPVAG  SV     P +L++  +SF  SI +  +G+
Sbjct:   34 ITDVFHKGNFQVTNNPIRVKRYEFSAPEPLIIISPKEAGVYPVLLFIHGTMLSNEDYSLFFNYIASHGFIVVAPKLFRLFPPKLPSQQDEIDMAASVANWMPLYLQVVLQRYVTGVEGDLEKLAISGHSRGGKSAFALALGF-SNIKLDVTFSALIGVDPVAG-RSVDDRTLPHVLTYKPNSFNLSIPVTVIGS 225          
BLAST of CX294797 vs. ExPASy Swiss-Prot
Match: CLH2_ARATH (Chlorophyllase-2, chloroplastic OS=Arabidopsis thaliana GN=CLH2 PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.408e-29
Identity = 67/150 (44.67%), Postives = 92/150 (61.33%), Query Frame = 3
Query:  156 PPKPLNIVYPEEKGTYEVILFFHGTALSNTSYSNLLDHLASHGYIVVAPQLYDFLPPKGNGEVNDAANVLNWLSTGLQSELPENVEANLNYVALMGHSRGGLIAFGLAL---GYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSH 596
            PPK L +  P E+G Y V++  HG  L N+ YS L+ H++SHG+I++APQLY    P    E+   A +++WLS GL   LP  V  NL+  AL GHSRGG  AF +AL   GY++N    +KIS L+GIDPV G      +  PP+L++
Sbjct:   41 PPKQLLVATPVEEGDYPVVMLLHGYLLYNSFYSQLMLHVSSHGFILIAPQLYSIAGPDTMDEIKSTAEIMDWLSVGLNHFLPAQVTPNLSKFALSGHSRGGKTAFAVALKKFGYSSN----LKISTLIGIDPVDGTGK-GKQTPPPVLAY 185          
The following BLAST results are available for this feature:
BLAST of CX294797 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
CLH1_CITUN2.681e-5054.76Chlorophyllase-1, chloroplastic OS=Citrus unshiu P... [more]
CLH1_CITSI3.872e-4953.81Chlorophyllase-1, chloroplastic OS=Citrus sinensis... [more]
CLH1_ARATH2.781e-3952.15Chlorophyllase-1 OS=Arabidopsis thaliana GN=CLH1 P... [more]
CLH0_CHEAL3.082e-3040.72Chlorophyllase type 0 OS=Chenopodium album GN=CACL... [more]
CLH2_ARATH3.408e-2944.67Chlorophyllase-2, chloroplastic OS=Arabidopsis tha... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05056A10SK PhIFruit1 Citrus clementina cDNA clone C05056A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294797 ID=CX294797|Name=CX294797|organism=Citrus clementina|type=EST|length=641bp
AAACAATTTAGACTACAATGACAGCAGTAGCCGATAGCAAGCCCGTCTCC
GTTGAAGCTAAGCCTGGTTTGGCAACGGCCTTACTATCAGTTTTTTCAAG
TGGACCTTATTCCCCGAAACTCAAGACAGTGAATAAACCATGGTTTAATA
GTTTTCCTCCAAAGCCGTTGAATATTGTTTATCCAGAAGAAAAAGGAACA
TATGAAGTTATTTTGTTTTTCCACGGCACTGCTCTCAGCAACACAAGCTA
TTCCAATCTCTTAGACCACTTGGCTTCCCATGGATACATCGTTGTTGCCC
CTCAGTTATACGATTTTCTGCCGCCGAAAGGAAACGGAGAAGTTAACGAT
GCAGCAAACGTCCTCAACTGGTTATCAACAGGCCTTCAATCAGAACTCCC
GGAAAATGTTGAAGCTAACCTAAACTACGTTGCTCTTATGGGACACAGTC
GCGGAGGACTAATAGCGTTCGGTCTGGCACTTGGCTATGCAACAAATCCT
CCAGTTAGCATTAAAATTTCAGCATTAGTAGGCATAGACCCAGTTGCGGG
GTTAGCCAGCGTTCATAGTGAACTTGAACCCCCGATTCTCAGTCATGACT
CATTCGAGTTCTCAATTCTGTTACTGTAATTGGGCACCGAC
back to top