CX294800

Overview
NameCX294800
Unique NameCX294800
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length542
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX294800_ssr477 microsatellite CX294800_ssr477:477..491. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CX294800 vs. ExPASy Swiss-Prot
Match: LOX6_ARATH (Lipoxygenase 6, choloroplastic OS=Arabidopsis thaliana GN=LOX6 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 3.559e-25
Identity = 54/84 (64.29%), Postives = 65/84 (77.38%), Query Frame = 2
Query:   26 HSPDEEYLGQVNQLHSHWINDPEVLNMFDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 277
            HSPDEEYL ++ ++  HW  D +V+  F+KFS  L +IEK IN RNKD +LK R GAG+PPYELLLP+S  GVTGRGIPNSISI
Sbjct:  834 HSPDEEYLIELREVQRHWFQDEQVVKYFNKFSEELVKIEKTINERNKDKKLKNRTGAGMPPYELLLPTSPHGVTGRGIPNSISI 917          
BLAST of CX294800 vs. ExPASy Swiss-Prot
Match: LOX4_ARATH (Lipoxygenase 4, chloroplastic OS=Arabidopsis thaliana GN=LOX4 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.003e-19
Identity = 47/84 (55.95%), Postives = 60/84 (71.43%), Query Frame = 2
Query:   26 HSPDEEYLGQVNQLHSHWINDPEVLNMFDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 277
            HSPDEEY+G+  Q  S W  D E+++ F  FSA +  IEK I+ RN+D   + RCGAG+ PYEL+ PSS PGVT RG+PNS+SI
Sbjct:  844 HSPDEEYIGE-RQQPSIWTGDAEIVDAFYGFSAEIGRIEKEIDKRNRDPSRRNRCGAGVLPYELMAPSSEPGVTCRGVPNSVSI 926          
BLAST of CX294800 vs. ExPASy Swiss-Prot
Match: LOX23_HORVU (Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare GN=LOX2.3 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.310e-19
Identity = 49/85 (57.65%), Postives = 59/85 (69.41%), Query Frame = 2
Query:   23 AHSPDEEYLGQVNQLHSHWINDPEVLNMFDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 277
            +HSPDEEY+G+  +    W+ +P V   F+KFS  L+E E  I+ RN +   K RCGAGI PYELL P S PGVTGRGIPNSISI
Sbjct:  814 SHSPDEEYMGEYAE--PAWLAEPMVKAAFEKFSGRLKEAEGTIDMRNNNPENKNRCGAGIVPYELLKPFSEPGVTGRGIPNSISI 896          
BLAST of CX294800 vs. ExPASy Swiss-Prot
Match: LOX3_ARATH (Lipoxygenase 3, chloroplastic OS=Arabidopsis thaliana GN=LOX3 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.811e-19
Identity = 47/84 (55.95%), Postives = 58/84 (69.05%), Query Frame = 2
Query:   26 HSPDEEYLGQVNQLHSHWINDPEVLNMFDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 277
            HSPDEEY+G+  Q  S W  D E++  F  F+A +  IEK I  RN D   + RCGAG+ PYELL+PSS PGVT RG+PNS+SI
Sbjct:  837 HSPDEEYIGE-RQQPSIWTGDAEIVEAFYGFAAEIGRIEKEIEKRNADPDRRNRCGAGVLPYELLVPSSEPGVTCRGVPNSVSI 919          
BLAST of CX294800 vs. ExPASy Swiss-Prot
Match: LOXC1_ORYSJ (Lipoxygenase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX1 PE=2 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 7.187e-18
Identity = 47/85 (55.29%), Postives = 58/85 (68.24%), Query Frame = 2
Query:   23 AHSPDEEYLGQVNQLHSHWINDPEVLNMFDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 277
            +HS DEEYLG   +    W +D  V   +D F+A L+EIE +I+ RNKD +LK RCGAGI PY+L+ P S  GVTG GIPNS SI
Sbjct:  842 SHSTDEEYLG--GEQTRPWNSDAAVQAAYDGFAARLKEIEGVIDGRNKDRKLKNRCGAGILPYQLMKPFSDSGVTGMGIPNSTSI 924          
BLAST of CX294800 vs. ExPASy Swiss-Prot
Match: LOXC2_ORYSJ (Probable lipoxygenase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX2 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 7.947e-17
Identity = 46/84 (54.76%), Postives = 56/84 (66.67%), Query Frame = 2
Query:   26 HSPDEEYLGQVNQLHSHWINDPEVLNMFDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 277
            HS DEEYLG   +    W +D  V   +  F+A L+EIE +I+ RNKD +LK RCGAGI PY+L+ P S  GVTG GIPNS SI
Sbjct:  860 HSTDEEYLG--GEQTRPWNSDAAVQAAYAGFTARLKEIEGVIDGRNKDRKLKNRCGAGILPYQLMKPFSDAGVTGMGIPNSTSI 941          
BLAST of CX294800 vs. ExPASy Swiss-Prot
Match: LOX2_ARATH (Lipoxygenase 2, chloroplastic OS=Arabidopsis thaliana GN=LOX2 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.312e-16
Identity = 41/84 (48.81%), Postives = 56/84 (66.67%), Query Frame = 2
Query:   26 HSPDEEYLGQVNQLHSHWINDPEVLNMFDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 277
            HSPDEEY+G+  Q  + W N+P +   F++F   L+ +E +I+ RN +  LK R GAG+  YELL P+S  GVTG G+P SISI
Sbjct:  815 HSPDEEYIGE--QQEASWANEPVINAAFERFKGKLQYLEGVIDERNVNITLKNRAGAGVVKYELLKPTSEHGVTGMGVPYSISI 896          
BLAST of CX294800 vs. ExPASy Swiss-Prot
Match: LOX5_ORYSJ (Putative lipoxygenase 5 OS=Oryza sativa subsp. japonica GN=Os04g0447100 PE=3 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 3.944e-16
Identity = 41/84 (48.81%), Postives = 55/84 (65.48%), Query Frame = 2
Query:   26 HSPDEEYLGQVNQLHSHWINDPEVLNMFDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 277
            HS DEEYLG+  +    W  DP  L    +F+A++   E+ I  RN D   + RCGAG+ PYEL+ PSSGPG+T RG+PNS++I
Sbjct:  818 HSADEEYLGE--RPDEAWTADPAALAAAREFAADVRRAEEEIERRNADPSRRNRCGAGVLPYELMAPSSGPGITCRGVPNSVTI 899          
BLAST of CX294800 vs. ExPASy Swiss-Prot
Match: LOX6_ORYSJ (Probable lipoxygenase 6 OS=Oryza sativa subsp. japonica GN=Os03g0179900 PE=2 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 5.151e-16
Identity = 44/85 (51.76%), Postives = 52/85 (61.18%), Query Frame = 2
Query:   26 HSPDEEYLGQVNQLHS-HWINDPEVLNMFDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 277
            HSPDEEYLG+        W  D   +     F+A++   E+ I  RN D   K RCGAG+ PYELL PSS PGVT RG+PNSISI
Sbjct:  834 HSPDEEYLGEGRDEGGVPWTADEAAVAAHGMFAADVRRAEETIERRNADHGRKNRCGAGVLPYELLAPSSPPGVTCRGVPNSISI 918          
BLAST of CX294800 vs. ExPASy Swiss-Prot
Match: LOX1_ARATH (Lipoxygenase 1 OS=Arabidopsis thaliana GN=LOX1 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.499e-15
Identity = 45/84 (53.57%), Postives = 52/84 (61.90%), Query Frame = 2
Query:   26 HSPDEEYLGQVNQLHSHWINDPEVLNMFDKFSANLEEIEKIINTRNKDFRLKGRCGAGIPPYELLLPSSGPGVTGRGIPNSISI 277
            HS DE YLGQ +     W  + E L  F+KF   ++EIEK I+ RN D  LK R G    PY LL PSS  GVTGRGIPNS+SI
Sbjct:  778 HSSDEVYLGQRDS--KEWAAEKEALEAFEKFGEKVKEIEKNIDERNDDETLKNRTGLVKMPYTLLFPSSEGGVTGRGIPNSVSI 859          
The following BLAST results are available for this feature:
BLAST of CX294800 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
LOX6_ARATH3.559e-2564.29Lipoxygenase 6, choloroplastic OS=Arabidopsis thal... [more]
LOX4_ARATH1.003e-1955.95Lipoxygenase 4, chloroplastic OS=Arabidopsis thali... [more]
LOX23_HORVU1.310e-1957.65Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare... [more]
LOX3_ARATH3.811e-1955.95Lipoxygenase 3, chloroplastic OS=Arabidopsis thali... [more]
LOXC1_ORYSJ7.187e-1855.29Lipoxygenase 7, chloroplastic OS=Oryza sativa subs... [more]
LOXC2_ORYSJ7.947e-1754.76Probable lipoxygenase 8, chloroplastic OS=Oryza sa... [more]
LOX2_ARATH2.312e-1648.81Lipoxygenase 2, chloroplastic OS=Arabidopsis thali... [more]
LOX5_ORYSJ3.944e-1648.81Putative lipoxygenase 5 OS=Oryza sativa subsp. jap... [more]
LOX6_ORYSJ5.151e-1651.76Probable lipoxygenase 6 OS=Oryza sativa subsp. jap... [more]
LOX1_ARATH1.499e-1553.57Lipoxygenase 1 OS=Arabidopsis thaliana GN=LOX1 PE=... [more]

Pages

back to top
Libraries
Library NameType
PhIFruit1cdna_library
Properties
Property NameValue
Genbank descriptionC05056B01SK PhIFruit1 Citrus clementina cDNA clone C05056B01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294800 ID=CX294800|Name=CX294800|organism=Citrus clementina|type=EST|length=542bp
CTCGTGCCGAATTCGGCACGAGGCTCACTCTCCTGATGAAGAGTATCTAG
GTCAGGTGAACCAGTTACACAGCCACTGGATCAATGACCCTGAAGTTTTG
AATATGTTTGATAAGTTCTCTGCTAATCTGGAGGAGATTGAAAAGATAAT
AAATACAAGAAATAAAGATTTCCGTCTTAAAGGCAGATGTGGTGCTGGCA
TTCCACCATATGAACTGCTTCTTCCTTCCTCTGGTCCGGGAGTAACTGGT
CGAGGAATCCCCAATAGTATTTCTATCTGATGGACTTAGCTAAATTGAGA
CAGTGGTAGATGCCTTTTTGTCACTATCGCTTAGTGCATACCATTTTATT
TCTGTGTTGTGCGGTTGTATGGACCTTCAATAGATCTTTTGGGGTTCGGT
ATTTGATATTAAAGCTCTGTAATTTGTGGGTAAAAGATATGATAGGACAC
AGAAAACTTGGAATATCATGATATTGGATCTGATCTGATCTTTGTAAAGC
AACATATAATATGCTGCAACTTATATTGAACATATCGTTTTC
back to top