CX294828
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX294828 vs. ExPASy Swiss-Prot
Match: HSBP1_PONAB (Heat shock factor-binding protein 1 OS=Pongo abelii GN=HSBP1 PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.685e-11 Identity = 33/59 (55.93%), Postives = 45/59 (76.27%), Query Frame = 2 Query: 134 DPKQSTADMTVFVQNLLQQMQSRFQTMSDSIVTKIDEMGNRINELEQSINDLRAEMGVE 310 DPK + D+T VQ LLQQMQ +FQTMSD I+ +ID+M +RI++LE++I DL + GVE Sbjct: 5 DPK-TVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVE 62
BLAST of CX294828 vs. ExPASy Swiss-Prot
Match: HSBP1_HUMAN (Heat shock factor-binding protein 1 OS=Homo sapiens GN=HSBP1 PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.685e-11 Identity = 33/59 (55.93%), Postives = 45/59 (76.27%), Query Frame = 2 Query: 134 DPKQSTADMTVFVQNLLQQMQSRFQTMSDSIVTKIDEMGNRINELEQSINDLRAEMGVE 310 DPK + D+T VQ LLQQMQ +FQTMSD I+ +ID+M +RI++LE++I DL + GVE Sbjct: 5 DPK-TVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVE 62
BLAST of CX294828 vs. ExPASy Swiss-Prot
Match: HSBP1_BOVIN (Heat shock factor-binding protein 1 OS=Bos taurus GN=HSBP1 PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.685e-11 Identity = 33/59 (55.93%), Postives = 45/59 (76.27%), Query Frame = 2 Query: 134 DPKQSTADMTVFVQNLLQQMQSRFQTMSDSIVTKIDEMGNRINELEQSINDLRAEMGVE 310 DPK + D+T VQ LLQQMQ +FQTMSD I+ +ID+M +RI++LE++I DL + GVE Sbjct: 5 DPK-TVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVE 62 The following BLAST results are available for this feature:
BLAST of CX294828 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX294828 ID=CX294828; Name=CX294828; organism=Citrus clementina; type=EST; length=576bpback to top |