CX294966

Overview
NameCX294966
Unique NameCX294966
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length642
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3541 contig Ccv1_Contig3541:53..694. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX294966 vs. ExPASy Swiss-Prot
Match: CIPK6_ARATH (CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 6.867e-30
Identity = 68/102 (66.67%), Postives = 78/102 (76.47%), Query Frame = 3
Query:  336 NSNGGGDDRPTLLHGKYELGRMLGHGTFAKVYLARNLQTGKSMAXXXXXXXXXXXXXXXEQIKREISVMKMVKHKHIVELHEVMASKSKIYFAMDLVKGGEL 641
            N + GG     LLHG+YELGR+LGHGTFAKVY ARN+QTGKS+A               +QIKREISVM+MVKH +IVELHEVMASKSKIYFAM+LV+GGEL
Sbjct:    9 NGSDGGSSTG-LLHGRYELGRLLGHGTFAKVYHARNIQTGKSVAMKVVGKEKVVKVGMVDQIKREISVMRMVKHPNIVELHEVMASKSKIYFAMELVRGGEL 109          
BLAST of CX294966 vs. ExPASy Swiss-Prot
Match: CIPKK_ARATH (CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 2.527e-24
Identity = 57/96 (59.38%), Postives = 70/96 (72.92%), Query Frame = 3
Query:  354 DDRPTLLHGKYELGRMLGHGTFAKVYLARNLQTGKSMAXXXXXXXXXXXXXXXEQIKREISVMKMVKHKHIVELHEVMASKSKIYFAMDLVKGGEL 641
            D    +L  KYELGR+LG GTFAKVY ARN++TG+S+A               +QIKREISVM++V+H H+V LHEVMASK+KIYFAM+ VKGGEL
Sbjct:    2 DKNGIVLMRKYELGRLLGQGTFAKVYHARNIKTGESVAIKVIDKQKVAKVGLIDQIKREISVMRLVRHPHVVFLHEVMASKTKIYFAMEYVKGGEL 97          
BLAST of CX294966 vs. ExPASy Swiss-Prot
Match: CIPK6_ORYSJ (CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.638e-23
Identity = 55/99 (55.56%), Postives = 73/99 (73.74%), Query Frame = 3
Query:  345 GGGDDRPTLLHGKYELGRMLGHGTFAKVYLARNLQTGKSMAXXXXXXXXXXXXXXXEQIKREISVMKMVKHKHIVELHEVMASKSKIYFAMDLVKGGEL 641
            GGG    T+L G+YE+GR+LGHG F +V++AR+L+TG+S+A               EQIKREI+VMK V H +IVELHEVMA++SKIY A++LV+GGEL
Sbjct:   14 GGG----TVLQGRYEMGRVLGHGNFGRVHVARDLRTGRSVAVKVVAKEKVVRAGMMEQIKREIAVMKRVSHPNIVELHEVMATRSKIYLALELVRGGEL 108          
BLAST of CX294966 vs. ExPASy Swiss-Prot
Match: CIPK5_ORYSJ (CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.139e-23
Identity = 54/96 (56.25%), Postives = 71/96 (73.96%), Query Frame = 3
Query:  354 DDRPTLLHGKYELGRMLGHGTFAKVYLARNLQTGKSMAXXXXXXXXXXXXXXXEQIKREISVMKMVKHKHIVELHEVMASKSKIYFAMDLVKGGEL 641
            + + ++L  +YELGRMLG GTFAKVY ARNL + +S+A               +QIKREIS+M++V+H +IV+LHEVMASKSKIYFAM+ V+GGEL
Sbjct:    2 EKKASILMNRYELGRMLGQGTFAKVYHARNLASNQSVAIKVIDKEKVLRVGMIDQIKREISIMRLVRHPNIVQLHEVMASKSKIYFAMEYVRGGEL 97          
BLAST of CX294966 vs. ExPASy Swiss-Prot
Match: CIPKJ_ARATH (CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 8.130e-23
Identity = 53/91 (58.24%), Postives = 67/91 (73.63%), Query Frame = 3
Query:  369 LLHGKYELGRMLGHGTFAKVYLARNLQTGKSMAXXXXXXXXXXXXXXXEQIKREISVMKMVKHKHIVELHEVMASKSKIYFAMDLVKGGEL 641
            L+ GKYE+GR+LGHGTFAKVYLARN Q+G+S+A                 IKREIS+++ V+H +IV+L EVMA+KSKIYF M+ VKGGEL
Sbjct:   23 LILGKYEMGRLLGHGTFAKVYLARNAQSGESVAIKVIDKEKVLKSGLIAHIKREISILRRVRHPNIVQLFEVMATKSKIYFVMEYVKGGEL 113          
BLAST of CX294966 vs. ExPASy Swiss-Prot
Match: CIPKB_ORYSJ (CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.035e-22
Identity = 51/95 (53.68%), Postives = 68/95 (71.58%), Query Frame = 3
Query:  357 DRPTLLHGKYELGRMLGHGTFAKVYLARNLQTGKSMAXXXXXXXXXXXXXXXEQIKREISVMKMVKHKHIVELHEVMASKSKIYFAMDLVKGGEL 641
            D  ++L G+YE+G+ LG GTFAKVY ARNL TG+++A               EQIKREIS+M++VKH ++++L EVMASKSKIYF ++  KGGEL
Sbjct:    3 DGRSILMGRYEVGKQLGQGTFAKVYYARNLTTGQAVAIKMINKDKVMKVGLMEQIKREISIMRLVKHPNVLQLFEVMASKSKIYFVLEYAKGGEL 97          
BLAST of CX294966 vs. ExPASy Swiss-Prot
Match: CIPKQ_ORYSJ (CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 5.270e-22
Identity = 52/96 (54.17%), Postives = 67/96 (69.79%), Query Frame = 3
Query:  354 DDRPTLLHGKYELGRMLGHGTFAKVYLARNLQTGKSMAXXXXXXXXXXXXXXXEQIKREISVMKMVKHKHIVELHEVMASKSKIYFAMDLVKGGEL 641
            DDR T+L  +YE+GR LG G FAKVY ARNL +G+++A                QIKREIS+M++VKH +I++L EVMASKSKIYF ++  KGGEL
Sbjct:    2 DDRRTILMDRYEIGRQLGQGNFAKVYYARNLTSGQAVAIKMIDKEKVTRVGLMVQIKREISIMRLVKHPNILQLFEVMASKSKIYFVLEYAKGGEL 97          
BLAST of CX294966 vs. ExPASy Swiss-Prot
Match: CIPKR_ORYSJ (Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.533e-21
Identity = 47/91 (51.65%), Postives = 68/91 (74.73%), Query Frame = 3
Query:  369 LLHGKYELGRMLGHGTFAKVYLARNLQTGKSMAXXXXXXXXXXXXXXXEQIKREISVMKMVKHKHIVELHEVMASKSKIYFAMDLVKGGEL 641
            +L G+YE+GR+LGHG F +V+ AR+++TG+++A               EQIKREI+VMKMV H  +VELHEVMA+++K+Y A++LV+GGEL
Sbjct:    6 VLEGRYEMGRVLGHGNFGRVHAARDVRTGRAVAMKVVSKDKVERAGMAEQIKREIAVMKMVSHPSVVELHEVMATRTKVYLALELVRGGEL 96          
BLAST of CX294966 vs. ExPASy Swiss-Prot
Match: CIPK2_ORYSJ (CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.002e-21
Identity = 51/96 (53.12%), Postives = 69/96 (71.88%), Query Frame = 3
Query:  354 DDRPTLLHGKYELGRMLGHGTFAKVYLARNLQTGKSMAXXXXXXXXXXXXXXXEQIKREISVMKMVKHKHIVELHEVMASKSKIYFAMDLVKGGEL 641
            + R  +L  KYE+G++LG GTFAKVY ARN +T +S+A               +QIKREISVMK+V+H +IV+L+EVMA+K+KIYF ++ VKGGEL
Sbjct:    3 EQRGNMLMKKYEMGKLLGQGTFAKVYHARNTETSESVAIKMIDKEKVLKGGLMDQIKREISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGEL 98          
BLAST of CX294966 vs. ExPASy Swiss-Prot
Match: CIPKF_ARATH (CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 2.615e-21
Identity = 52/96 (54.17%), Postives = 69/96 (71.88%), Query Frame = 3
Query:  354 DDRPTLLHGKYELGRMLGHGTFAKVYLARNLQTGKSMAXXXXXXXXXXXXXXXEQIKREISVMKMVKHKHIVELHEVMASKSKIYFAMDLVKGGEL 641
            + + ++L  +YE+G+ LG GTFAKVY AR+L+TG S+A               EQIKREIS M++++H +IVELHEVMA+KSKIYF M+ VKGGEL
Sbjct:    2 EKKGSVLMLRYEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDKERILKVGMTEQIKREISAMRLLRHPNIVELHEVMATKSKIYFVMEHVKGGEL 97          
The following BLAST results are available for this feature:
BLAST of CX294966 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 61
Match NameE-valueIdentityDescription
CIPK6_ARATH6.867e-3066.67CBL-interacting serine/threonine-protein kinase 6 ... [more]
CIPKK_ARATH2.527e-2459.38CBL-interacting serine/threonine-protein kinase 20... [more]
CIPK6_ORYSJ1.638e-2355.56CBL-interacting protein kinase 6 OS=Oryza sativa s... [more]
CIPK5_ORYSJ2.139e-2356.25CBL-interacting protein kinase 5 OS=Oryza sativa s... [more]
CIPKJ_ARATH8.130e-2358.24CBL-interacting serine/threonine-protein kinase 19... [more]
CIPKB_ORYSJ4.035e-2253.68CBL-interacting protein kinase 11 OS=Oryza sativa ... [more]
CIPKQ_ORYSJ5.270e-2254.17CBL-interacting protein kinase 26 OS=Oryza sativa ... [more]
CIPKR_ORYSJ1.533e-2151.65Putative CBL-interacting protein kinase 27 OS=Oryz... [more]
CIPK2_ORYSJ2.002e-2153.13CBL-interacting protein kinase 2 OS=Oryza sativa s... [more]
CIPKF_ARATH2.615e-2154.17CBL-interacting serine/threonine-protein kinase 15... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05065B05SK DroRLeaf1 Citrus clementina cDNA clone C05065B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294966 ID=CX294966|Name=CX294966|organism=Citrus clementina|type=EST|length=642bp
CTCCCGGTAAACCCATCGATAAGCCTTTGATCAATAGCAGCAAATCAAAA
TCCTTCTCGTCTCCCCCCAAGAAAAAATAAATAAGCAAACACTACAAGCC
CCTTCAGGGAATGCAGAGAGATGAGAGGACCTTCGTGGAGATTGCCTGAG
CTGTGTTTACGTGCCCAGCGGTGCGTCGGCGGCCGTAATTGCCACCGGAA
ACACGTCGAAGACGGGTGATCCTCAACCACCACCACAACACAAAAGAAAA
CCTGAAAGAATTATTTAATTAGCTAAACTTGGTACATATATACGTATAAA
AGGAAAAAAAAGACCGCGTGGAGATGGCTACATCAAACAGTAACGGCGGA
GGCGATGACAGGCCGACGTTGCTACATGGGAAATACGAGCTGGGGCGTAT
GCTAGGCCACGGAACCTTCGCGAAGGTGTACCTGGCAAGAAATTTGCAGA
CGGGGAAAAGCATGGCCATGAAAGTTGTTGGTAAAGACAAGGTTATCAAG
GTGGGCATGATGGAGCAAATCAAGCGTGAAATCTCTGTCATGAAGATGGT
GAAGCACAAGCACATAGTTGAGCTACACGAAGTCATGGCAAGTAAGTCCA
AGATTTACTTCGCCATGGACCTCGTCAAAGGCGGCGAGCTGT
back to top