CX295023

Overview
NameCX295023
Unique NameCX295023
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length748
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX295023 vs. ExPASy Swiss-Prot
Match: FACR2_ARATH (Fatty acyl-CoA reductase 2 OS=Arabidopsis thaliana GN=FAR2 PE=2 SV=2)

HSP 1 Score: 229.18 bits (583), Expect = 1.880e-59
Identity = 119/210 (56.67%), Postives = 156/210 (74.29%), Query Frame = 1
Query:   73 GIGIEKFLVGKSFFVTGATGFLAKVLIEKILRAAPEVGKIFLLIKAESEEAASKRLKDEVINAELFKCLQQTYGECYQDFMLNILVPVVGNISEINLGLEGNLATVIANEVDVIINSAASITFHERYDIAIDINTRGPSHVMNFTXXXXXXXXXXHMSTAFANGKRQGRTMEKPFYMGDTIARELNFNNSKTEPKLDVEKEIGLAMKSKK 702
            G+GI  FL GK F +TG+TGFLAKVLIEK+LR AP+V KI+LLIKA+S+EAA +RLK+EV++AELF  L++T+G  Y  FML  L+PV GNI + N+GL+ + A  IA EVDVIINSAA+ TF+ERYD+A+DINTRGP ++M F            +STA+ NG+RQGR MEKPF MGD IA E NF     +  LDV++E+ LA+++ +
Sbjct:  121 GLGIISFLQGKKFLITGSTGFLAKVLIEKVLRMAPDVSKIYLLIKAKSKEAAIERLKNEVLDAELFNTLKETHGASYMSFMLTKLIPVTGNICDSNIGLQADSAEEIAKEVDVIINSAANTTFNERYDVALDINTRGPGNLMGFAKKCKKLKLFLQVSTAYVNGQRQGRIMEKPFSMGDCIATE-NFLEGNRK-ALDVDREMKLALEAAR 328          
BLAST of CX295023 vs. ExPASy Swiss-Prot
Match: FACR6_ARATH (Fatty acyl-CoA reductase 6, chloroplastic OS=Arabidopsis thaliana GN=FAR6 PE=2 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 5.674e-48
Identity = 95/199 (47.74%), Postives = 137/199 (68.84%), Query Frame = 1
Query:   73 GIGIEKFLVGKSFFVTGATGFLAKVLIEKILRAAPEVGKIFLLIKAESEEAASKRLKDEVINAELFKCLQQTYGECYQDFMLNILVPVVGNISEINLGLEGNLATVIANEVDVIINSAASITFHERYDIAIDINTRGPSHVMNFTXXXXXXXXXXHMSTAFANGKRQGRTMEKPFYMGDTIARELNFNNSKTEPKLDVE 669
            GIGI +FL GKS+ VTGATGFLAKVLIEK+LR + E+GKIFLL++++ +E+A+KRL DE+I+++LFK L+Q +G  Y+ FM   L+PV+G+I E NLG++  +A +I+ E+DVII+     TF +RYD A+ +N  GP  +++F           H STA+  GKR+G  +E P  +G+ I  +LN    K+E KL  E
Sbjct:   74 GIGIVRFLEGKSYLVTGATGFLAKVLIEKLLRESLEIGKIFLLMRSKDQESANKRLYDEIISSDLFKLLKQMHGSSYEAFMKRKLIPVIGDIEEDNLGIKSEIANMISEEIDVIISCGGRTTFDDRYDSALSVNALGPGRLLSFGKGCRKLKLFLHFSTAYVTGKREGTVLETPLCIGENITSDLNI---KSELKLASE 269          
BLAST of CX295023 vs. ExPASy Swiss-Prot
Match: FACR1_ARATH (Fatty acyl-CoA reductase 1 OS=Arabidopsis thaliana GN=FAR1 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 6.508e-36
Identity = 86/187 (45.99%), Postives = 122/187 (65.24%), Query Frame = 1
Query:   88 KFLVGKSFFVTGATGFLAKVLIEKILRAAPEVGKIFLLIKAESEEAASKRLKDEVINAELFKCLQQTYGE-CYQDFMLNILVPVVGNISEINLGL-EGNLATVIANEVDVIINSAASITFHERYDIAIDINTRGPSHVMNFTXXXXXXXXXXHMSTAFANGKRQGRTMEKPFYMGDTIA--RELNFN 636
            +FL  K+  +TGA GFLAKVL+EKILR  P V KI+LL++A  E++A +RL+ EV+  +LFK L+   GE      M   +VPV G+IS  NLGL + +L   + +E+D+IIN AA+  F ERYDI + INT G  +V+NF           H+STA+ +G++ G  +EKPF MG+T++  REL+ N
Sbjct:    7 QFLGNKTILITGAPGFLAKVLVEKILRLQPNVKKIYLLLRAPDEKSAMQRLRSEVMEIDLFKVLRNNLGEDNLNALMREKIVPVPGDISIDNLGLKDTDLIQRMWSEIDIIINIAATTNFDERYDIGLGINTFGALNVLNFAKKCVKGQLLLHVSTAYISGEQPGLLLEKPFKMGETLSGDRELDIN 193          
BLAST of CX295023 vs. ExPASy Swiss-Prot
Match: FACR4_ARATH (Probable fatty acyl-CoA reductase 4 OS=Arabidopsis thaliana GN=FAR4 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 5.509e-35
Identity = 84/216 (38.89%), Postives = 126/216 (58.33%), Query Frame = 1
Query:   88 KFLVGKSFFVTGATGFLAKVLIEKILRAAPEVGKIFLLIKAESEEAASKRLKDEVINAELFKCLQQTYG-ECYQDFMLNILVPVVGNISEINLGLEGN-LATVIANEVDVIINSAASITFHERYDIAIDINTRGPSHVMNFTXXXXXXXXXXHMSTAFANGKRQGRTMEKPFYMGDTIARELNFNNSKTEPKLDVEKEIGLAMKSKKPLEMMKMLE 729
            +FL  K+  VTG  GFLAKV +EKILR  P+V K+FLL++A   E+A +R   EV+  +LF+ L+   G E  + F+   +VP+ G+IS  NLG++G+ L   + NE+D+I+N AA+  F ERYD+ + +NT GP +V+NF           H+STA+  G++ G   EK F+MG+T+             KL +E E+ L  +  K L+     E
Sbjct:    7 QFLHDKTILVTGVPGFLAKVFVEKILRIQPKVKKLFLLLRAADNESAMQRFHSEVLEKDLFRVLKNALGDENLKAFITEKVVPIPGDISVDNLGVKGSDLLQHMWNEIDIIVNVAATTNFDERYDVGLSVNTFGPLNVLNFAKKCVKGQLLLHVSTAYVRGEKSGLLHEKTFHMGETL---------NGHRKLVIETEMELMKQKLKELQKQNCSE 213          
BLAST of CX295023 vs. ExPASy Swiss-Prot
Match: FACR3_ARATH (Fatty acyl-CoA reductase 3 OS=Arabidopsis thaliana GN=FAR3 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.093e-34
Identity = 79/209 (37.80%), Postives = 123/209 (58.85%), Query Frame = 1
Query:   76 IGIEKFLVGKSFFVTGATGFLAKVLIEKILRAAPEVGKIFLLIKAESEEAASKRLKDEVINAELFKCLQQTYGECYQDFMLNILVPVVGNISEINLGLEG-NLATVIANEVDVIINSAASITFHERYDIAIDINTRGPSHVMNFTXXXXXXXXXXHMSTAFANGKRQGRTMEKPFYMGDTI----ARELNFNNSKTEPKLDVEKEIGLA 687
            + + K+L  KS  V GA GFLA + +EKILR AP V K++LL++A   ++A++R  DE++  +LFK L++ YG          +  V G+I   +LGL+  +LA  + ++VD I+N AA+  F ERYD+A+ INT G  +V+NF           H+STA+  G++ G  ME P+ MG+T+      ++N+     + KLD  + IG A
Sbjct:    8 VSVLKYLDNKSILVVGAAGFLANIFVEKILRVAPNVKKLYLLLRASKGKSATQRFNDEILKKDLFKVLKEKYGPNLNQLTSEKITIVDGDICLEDLGLQDFDLAHEMIHQVDAIVNLAATTKFDERYDVALGINTLGALNVLNFAKRCAKVKILVHVSTAYVCGEKSGLIMETPYRMGETLNGTTGLDINYEKKLVQEKLDQLRVIGAA 216          
BLAST of CX295023 vs. ExPASy Swiss-Prot
Match: FACR8_ARATH (Fatty acyl-CoA reductase 8 OS=Arabidopsis thaliana GN=FAR8 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 8.795e-33
Identity = 78/198 (39.39%), Postives = 117/198 (59.09%), Query Frame = 1
Query:   91 FLVGKSFFVTGATGFLAKVLIEKILRAAPEVGKIFLLIKAESEEAASKRLKDEVINAELFKCLQQTYG-ECYQDFMLNILVPVVGNISEINLGL-EGNLATVIANEVDVIINSAASITFHERYDIAIDINTRGPSHVMNFTXXXXXXXXXXHMSTAFANGKRQGRTMEKPFYMGDTIARELNFNNSKTEPKLDVEKEI 678
            FL  K+  VTGATGFLAKV +EKILR  P V K++L+++A   EAA+KRL+ E    +LFK L+   G E     +   +VPV G+I+  +LG+ + NL   +  E+D+++N AA+  F ERYDI + INT G  +V+NF           H+STA+  G++ G   EKPF M +        N +  +  +++E+E+
Sbjct:    8 FLQNKTILVTGATGFLAKVFVEKILRVQPNVNKLYLVVRASDNEAATKRLRTEAFEKDLFKVLRDNLGDEKLNTLLSEKVVPVAGDIAMDHLGMKDSNLRERMQKEIDIVVNVAATTNFDERYDIGLGINTFGALNVLNFAKKCVKAQLLLHVSTAYVCGEKPGLLPEKPFVMEEIC------NENGLQLDINLEREL 199          
BLAST of CX295023 vs. ExPASy Swiss-Prot
Match: FACR5_ARATH (Probable fatty acyl-CoA reductase 5 OS=Arabidopsis thaliana GN=FAR5 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.149e-32
Identity = 86/216 (39.81%), Postives = 123/216 (56.94%), Query Frame = 1
Query:   88 KFLVGKSFFVTGATGFLAKVLIEKILRAAPEVGKIFLLIKAESEEAASKRLKDEVINAELFKCLQQTYG-ECYQDFMLNILVPVVGNISEINLGL-EGNLATVIANEVDVIINSAASITFHERYDIAIDINTRGPSHVMNFTXXXXXXXXXXHMSTAFANGKRQGRTMEKPFYMGD-----------TIARELNFNNSKTEPKLDV-EKEIGLAMK 693
            +FL  K+  VTGATGFLAKV +EKILR  P V K++LL++A   EAA+KRL+ EV   ELFK L+Q  G E     +   +V V G+I+   LG+ + +L   +  E+D+++N AA+  F ERYD+ + INT G  +V+NF           H+STA+  G++ G   EKPF M +            + REL     K   + D  E++I L+MK
Sbjct:    7 QFLRNKTILVTGATGFLAKVFVEKILRVQPNVKKLYLLVRASDNEAATKRLRTEVFEKELFKVLRQNLGDEKLNTLLYEKVVSVPGDIATDQLGINDSHLRERMQKEIDIVVNVAATTNFDERYDVGLGINTFGALNVLNFAKKCVKVQLLLHVSTAYVCGEKPGLIPEKPFIMEEIRNENGLQLDINLERELMKQRLKELNEQDCSEEDITLSMK 222          
BLAST of CX295023 vs. ExPASy Swiss-Prot
Match: FACR1_DROME (Putative fatty acyl-CoA reductase CG5065 OS=Drosophila melanogaster GN=CG5065 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.032e-21
Identity = 60/188 (31.91%), Postives = 102/188 (54.26%), Query Frame = 1
Query:   76 IGIEKFLVGKSFFVTGATGFLAKVLIEKILRAAPEVGKIFLLIKAESEEAASKRLKDEVINAELFKCLQQTYGECYQDFMLNILVPVVGNISEINLGLEGNLATVIANEVDVIINSAASITFHERYDIAIDINTRGPSHVMNFTXXXXXXXXXXHMSTAFANGKRQ--GRTMEKPFYMGDTIARELNF 633
            + I +F  G+S F+TG TGF+ KVL+EK+LR+ PE+  I+LLI+ +  +  S RL  E++NA LF+ L+Q      +   L+ ++P+ G+I+   LG+      ++   V V+ +SAA++ F E+  +++ IN  G   ++             H+STA+ N  R      +  P Y  D I   +N+
Sbjct:  117 VPIAQFYAGRSVFITGGTGFMGKVLVEKLLRSCPEIRNIYLLIRPKRGQEVSARL-TELLNAPLFESLRQE-----KPKELSKVIPISGDITSEELGISEKDQNLLCRNVSVVFHSAATVKFDEKLKLSVTINMLGTKRLVELCHRMLSLDALIHVSTAYCNCDRTDVSEVIYAPPYNPDDIISLINW 298          
BLAST of CX295023 vs. ExPASy Swiss-Prot
Match: FACR2_DROME (Putative fatty acyl-CoA reductase CG8303 OS=Drosophila melanogaster GN=CG8303 PE=2 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 2.325e-17
Identity = 55/172 (31.98%), Postives = 86/172 (50.00%), Query Frame = 1
Query:   82 IEKFLVGKSFFVTGATGFLAKVLIEKILRAAPEVGKIFLLIKAESEEAASKRLKDEVINAELFKCLQQTYGECYQDFMLNILVPVVGNISEINLGLEGNLATVIANEVDVIINSAASITFHERYDIAIDINTRGPSHVMNFTXXXXXXXXXXHMSTAFANGKRQGRTMEKPF 597
            I +F   K+ FVTG TGFL  VLIE +L   P++G I++L++ + +   ++R++         + LQ+   E Y +  L+ +VPVVG +SE N G    L   + + V+VI +SAA+I F      AI  N  G    +             + STAF N   +G   E+ +
Sbjct:  116 IPEFFAHKNIFVTGGTGFLGTVLIEALLDTHPDIGTIYVLVRGKRKFDPNERIR---------RLLQKPIFEKYSEKTLSKVVPVVGELSEPNFGFGPELLQELIDRVNVIYHSAATIKFSSPLRTAIRTNLTGTMRTIELAKQLKQLAAYIYCSTAFCNSNNRGLIAEEVY 278          
BLAST of CX295023 vs. ExPASy Swiss-Prot
Match: FACR3_DROME (Putative fatty acyl-CoA reductase CG8306 OS=Drosophila melanogaster GN=CG8306 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.276e-15
Identity = 46/160 (28.75%), Postives = 85/160 (53.12%), Query Frame = 1
Query:   82 IEKFLVGKSFFVTGATGFLAKVLIEKILRAAPEVGKIFLLIKAESEEAASKRLKDEVINAELFKCLQQTYGECYQDFMLNILVPVVGNISEINLGLEGNLATVIANEVDVIINSAASITFHERYDIAIDINTRGPSHVMNFTXXXXXXXXXXHMSTAFAN 561
            I  F  G++ F+TGATGF+   ++EK+LR  P VG ++LL++A+  ++  +RL++   N+   K     + E      L+ +VP+ G++   +LG+       + + V+V+ +SAA++ F +      +IN RG   V+             H+S+A+ N
Sbjct:    6 ITDFYAGRNVFITGATGFVGVTIVEKLLRDVPNVGTLYLLMRAKKGKSVQERLEELKKNSVFDK-----FKELQLQSRLSKIVPIEGDVGLEHLGISPKDRQTLIDNVNVVFHSAATLDFFQSLKETTNINLRGTRRVVELCQQIKNLDALVHVSSAYVN 160          
The following BLAST results are available for this feature:
BLAST of CX295023 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
FACR2_ARATH1.880e-5956.67Fatty acyl-CoA reductase 2 OS=Arabidopsis thaliana... [more]
FACR6_ARATH5.674e-4847.74Fatty acyl-CoA reductase 6, chloroplastic OS=Arabi... [more]
FACR1_ARATH6.508e-3645.99Fatty acyl-CoA reductase 1 OS=Arabidopsis thaliana... [more]
FACR4_ARATH5.509e-3538.89Probable fatty acyl-CoA reductase 4 OS=Arabidopsis... [more]
FACR3_ARATH2.093e-3437.80Fatty acyl-CoA reductase 3 OS=Arabidopsis thaliana... [more]
FACR8_ARATH8.795e-3339.39Fatty acyl-CoA reductase 8 OS=Arabidopsis thaliana... [more]
FACR5_ARATH1.149e-3239.81Probable fatty acyl-CoA reductase 5 OS=Arabidopsis... [more]
FACR1_DROME2.032e-2131.91Putative fatty acyl-CoA reductase CG5065 OS=Drosop... [more]
FACR2_DROME2.325e-1731.98Putative fatty acyl-CoA reductase CG8303 OS=Drosop... [more]
FACR3_DROME1.276e-1528.75Putative fatty acyl-CoA reductase CG8306 OS=Drosop... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05065G05SK DroRLeaf1 Citrus clementina cDNA clone C05065G05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295023 ID=CX295023; Name=CX295023; organism=Citrus clementina; type=EST; length=748bp
GAGGCGCAGACTCCATCTCTGCATCTTCACTTGAAAATGGCGAAAAATTC
AGCCCAATACTCAAAGCAATACGGTATTGGTATTGAAAAATTTCTTGTAG
GGAAGAGCTTTTTTGTTACTGGGGCAACAGGATTTCTCGCAAAGGTTCTT
ATAGAGAAGATATTACGAGCAGCGCCTGAGGTGGGTAAGATATTTCTTTT
GATCAAGGCAGAAAGTGAAGAAGCTGCATCGAAAAGATTAAAAGATGAAG
TCATCAATGCGGAACTTTTCAAGTGTCTTCAGCAAACCTATGGGGAATGC
TACCAAGATTTCATGTTAAATATATTGGTTCCTGTGGTAGGAAATATAAG
TGAAATTAACCTTGGATTAGAAGGAAATTTAGCCACTGTGATCGCAAATG
AGGTCGACGTAATTATAAATTCTGCGGCCAGTATAACCTTTCATGAAAGA
TATGACATTGCTATCGATATAAACACAAGAGGACCTTCCCATGTTATGAA
TTTTACAAAAAAGTGCAAGAAGGTTAAGGTTTTTGTGCACATGTCAACAG
CATTTGCTAATGGAAAGAGACAAGGAAGGACTATGGAAAAGCCCTTCTAC
ATGGGGGATACGATAGCAAGGGAATTAAACTTCAACAACTCCAAAACTGA
ACCAAAATTGGACGTTGAAAAAGAAATAGGGTTGGCTATGAAATCCAAAA
AGCCCCTTGAAATGATGAAGATGCTCGAAAGAAATGAAGGAATTGGGT
back to top