CX295107

Overview
NameCX295107
Unique NameCX295107
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length714
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX295107 vs. ExPASy Swiss-Prot
Match: TIP21_ARATH (Aquaporin TIP2-1 OS=Arabidopsis thaliana GN=TIP2-1 PE=1 SV=2)

HSP 1 Score: 216.083 bits (549), Expect = 1.501e-55
Identity = 121/211 (57.35%), Postives = 133/211 (63.03%), Query Frame = 2
Query:   80 IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFSNLPSSFALKHIIKKLCCNINQP*L**LIDGHANTLTVXXXXXXXXXXXLTDKMTADAALDPSGLVAIAICHGFALFVAVAIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVTGGLAVPTHNXXXXXXXXXXXXXXXXXTFGLVYTVYATAAD 712
            +AFG FDDSFSL S +AYLAEFISTLLFVFAGVGSAIA++                                                   K+T+DAALD  GLVAIA+CHGFALFVAVAIGANISGGHVNPAVTFGLA+GGQIT++TG+FYWIAQLLGS  A FLLK VTGGLAVPTH+                 TF LVYTVYATAAD
Sbjct:    4 VAFGSFDDSFSLASLRAYLAEFISTLLFVFAGVGSAIAYA---------------------------------------------------KLTSDAALDTPGLVAIAVCHGFALFVAVAIGANISGGHVNPAVTFGLAVGGQITVITGVFYWIAQLLGSTAACFLLKYVTGGLAVPTHSVAAGLGSIEGVVMEIIITFALVYTVYATAAD 163          
BLAST of CX295107 vs. ExPASy Swiss-Prot
Match: TIP22_ORYSJ (Probable aquaporin TIP2-2 OS=Oryza sativa subsp. japonica GN=TIP2-2 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 7.214e-50
Identity = 115/211 (54.50%), Postives = 129/211 (61.14%), Query Frame = 2
Query:   80 IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFSNLPSSFALKHIIKKLCCNINQP*L**LIDGHANTLTVXXXXXXXXXXXLTDKMTADAALDPSGLVAIAICHGFALFVAVAIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVTGGLAVPTHNXXXXXXXXXXXXXXXXXTFGLVYTVYATAAD 712
            IAFGRFDDSFS  S KAY+AEFISTL+FVFAGVGSAIA++                                                   K+T  A LDP+GLVA+A+CHGF LFVAVAIGANISGGHVNPAVTFGLALGGQITILTG+FYWIAQLLG+IV + L++  T G+A PTH                  TFGLVYTVYATAAD
Sbjct:    5 IAFGRFDDSFSAASLKAYVAEFISTLVFVFAGVGSAIAYT---------------------------------------------------KLTGGAPLDPAGLVAVAVCHGFGLFVAVAIGANISGGHVNPAVTFGLALGGQITILTGVFYWIAQLLGAIVGAVLVQFCT-GVATPTHG-LSGVGAFEGVVMEIIVTFGLVYTVYATAAD 162          
BLAST of CX295107 vs. ExPASy Swiss-Prot
Match: TIP2_TOBAC (Probable aquaporin TIP-type RB7-18C OS=Nicotiana tabacum PE=2 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 1.231e-49
Identity = 113/211 (53.55%), Postives = 125/211 (59.24%), Query Frame = 2
Query:   80 IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFSNLPSSFALKHIIKKLCCNINQP*L**LIDGHANTLTVXXXXXXXXXXXLTDKMTADAALDPSGLVAIAICHGFALFVAVAIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVTGGLAVPTHNXXXXXXXXXXXXXXXXXTFGLVYTVYATAAD 712
            IAFG   DSFS+GS KAY+AEFI+TLLFVFAGVGSAIA++                                                   K+TADAALDP+GLVA+A+ H FALFV V+I ANISGGH+NPAVT GLA+GG ITILTG FYWIAQLLGS VA  LLK VT GLAVPTH                  TF LVYTVYATAAD
Sbjct:    4 IAFGSIGDSFSVGSLKAYVAEFIATLLFVFAGVGSAIAYN---------------------------------------------------KLTADAALDPAGLVAVAVAHAFALFVGVSIAANISGGHLNPAVTLGLAVGGNITILTGFFYWIAQLLGSTVACLLLKYVTNGLAVPTHGVAAGLNGFQGVVMEIIITFALVYTVYATAAD 163          
BLAST of CX295107 vs. ExPASy Swiss-Prot
Match: TIP1_TOBAC (Probable aquaporin TIP-type RB7-5A OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.231e-49
Identity = 113/211 (53.55%), Postives = 125/211 (59.24%), Query Frame = 2
Query:   80 IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFSNLPSSFALKHIIKKLCCNINQP*L**LIDGHANTLTVXXXXXXXXXXXLTDKMTADAALDPSGLVAIAICHGFALFVAVAIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVTGGLAVPTHNXXXXXXXXXXXXXXXXXTFGLVYTVYATAAD 712
            IAFG   DSFS+GS KAY+AEFI+TLLFVFAGVGSAIA++                                                   K+TADAALDP+GLVA+A+ H FALFV V+I ANISGGH+NPAVT GLA+GG ITILTG FYWIAQLLGS VA  LLK VT GLAVPTH                  TF LVYTVYATAAD
Sbjct:    4 IAFGSIGDSFSVGSLKAYVAEFIATLLFVFAGVGSAIAYN---------------------------------------------------KLTADAALDPAGLVAVAVAHAFALFVGVSIAANISGGHLNPAVTLGLAVGGNITILTGFFYWIAQLLGSTVACLLLKYVTNGLAVPTHGVAAGLNGLQGVVMEIIITFALVYTVYATAAD 163          
BLAST of CX295107 vs. ExPASy Swiss-Prot
Match: TIP_ANTMA (Probable aquaporin TIP-type OS=Antirrhinum majus GN=DIP PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.965e-47
Identity = 107/211 (50.71%), Postives = 124/211 (58.77%), Query Frame = 2
Query:   80 IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFSNLPSSFALKHIIKKLCCNINQP*L**LIDGHANTLTVXXXXXXXXXXXLTDKMTADAALDPSGLVAIAICHGFALFVAVAIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVTGGLAVPTHNXXXXXXXXXXXXXXXXXTFGLVYTVYATAAD 712
            IAFG   DSFS+ S KAY+AEFI+TLLFVFAGVGSAIA++                                                   K+T+DAALDP+GLVA+A+ H FALFV V++ AN+SGGH+NPAVT GLA+GG ITILTG+FYWIAQ LGS VA  LLK VT GL+VPTH                  TF LVYTVYATAAD
Sbjct:    4 IAFGSIGDSFSVASIKAYVAEFIATLLFVFAGVGSAIAYN---------------------------------------------------KLTSDAALDPAGLVAVAVAHAFALFVGVSMAANVSGGHLNPAVTLGLAVGGNITILTGLFYWIAQCLGSTVACLLLKFVTNGLSVPTHGVAAGMDAIQGVVMEIIITFALVYTVYATAAD 163          
BLAST of CX295107 vs. ExPASy Swiss-Prot
Match: TIP22_ARATH (Probable aquaporin TIP2-2 OS=Arabidopsis thaliana GN=TIP2-2 PE=1 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 5.350e-45
Identity = 104/211 (49.29%), Postives = 120/211 (56.87%), Query Frame = 2
Query:   80 IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFSNLPSSFALKHIIKKLCCNINQP*L**LIDGHANTLTVXXXXXXXXXXXLTDKMTADAALDPSGLVAIAICHGFALFVAVAIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVTGGLAVPTHNXXXXXXXXXXXXXXXXXTFGLVYTVYATAAD 712
            I  G   DSFS+ S KAYL+EFI+TLLFVFAGVGSA+AF+                                                   K+T+DAALDP+GLVA+A+ H FALFV V+I ANISGGH+NPAVT GLA+GG IT++TG FYWIAQ LGSIVA  LL  VT G +VPTH                  TF LVYTVYATAAD
Sbjct:    4 IEIGSVGDSFSVASLKAYLSEFIATLLFVFAGVGSALAFA---------------------------------------------------KLTSDAALDPAGLVAVAVAHAFALFVGVSIAANISGGHLNPAVTLGLAVGGNITVITGFFYWIAQCLGSIVACLLLVFVTNGESVPTHGVAAGLGAIEGVVMEIVVTFALVYTVYATAAD 163          
BLAST of CX295107 vs. ExPASy Swiss-Prot
Match: TIP23_ARATH (Aquaporin TIP2-3 OS=Arabidopsis thaliana GN=TIP2-3 PE=1 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 6.988e-45
Identity = 105/211 (49.76%), Postives = 119/211 (56.40%), Query Frame = 2
Query:   80 IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFSNLPSSFALKHIIKKLCCNINQP*L**LIDGHANTLTVXXXXXXXXXXXLTDKMTADAALDPSGLVAIAICHGFALFVAVAIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVTGGLAVPTHNXXXXXXXXXXXXXXXXXTFGLVYTVYATAAD 712
            I  G   DSFS+ S KAYL+EFI+TLLFVFAGVGSA+AF+                                                   K+T+D ALDP+GLVAIAI H FALFV V+I ANISGGH+NPAVT GLA+GG IT++TG FYWIAQ LGSIVA  LL  VT G +VPTH                  TF LVYTVYATAAD
Sbjct:    4 IEVGSVGDSFSVSSLKAYLSEFIATLLFVFAGVGSAVAFA---------------------------------------------------KLTSDGALDPAGLVAIAIAHAFALFVGVSIAANISGGHLNPAVTLGLAIGGNITLITGFFYWIAQCLGSIVACLLLVFVTNGKSVPTHGVSAGLGAVEGVVMEIVVTFALVYTVYATAAD 163          
BLAST of CX295107 vs. ExPASy Swiss-Prot
Match: TIP23_MAIZE (Aquaporin TIP2-3 OS=Zea mays GN=TIP2-3 PE=2 SV=2)

HSP 1 Score: 177.948 bits (450), Expect = 4.529e-44
Identity = 106/211 (50.24%), Postives = 121/211 (57.35%), Query Frame = 2
Query:   80 IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFSNLPSSFALKHIIKKLCCNINQP*L**LIDGHANTLTVXXXXXXXXXXXLTDKMTADAALDPSGLVAIAICHGFALFVAVAIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVTGGLAVPTHNXXXXXXXXXXXXXXXXXTFGLVYTVYATAAD 712
            +AFG F DS S  S KAY+AEFI+TLLFVFAGVGSAIA+S                                                   ++T   ALDP+GLVAIAI H FALFV V++ ANISGGH+NPAVTFGLA+GG ITILTGI YW+AQLLG+ VA FLL+ VT G A+PTH                  TF LVYTVYATAAD
Sbjct:    4 LAFGSFRDSLSAASLKAYVAEFIATLLFVFAGVGSAIAYS---------------------------------------------------QLTKGGALDPAGLVAIAIAHAFALFVGVSMAANISGGHLNPAVTFGLAVGGHITILTGILYWVAQLLGASVACFLLQYVTHGQAIPTHG-VSGISEIEGVVMEIVITFALVYTVYATAAD 162          
BLAST of CX295107 vs. ExPASy Swiss-Prot
Match: TIP22_MAIZE (Aquaporin TIP2-2 OS=Zea mays GN=TIP2-2 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.009e-43
Identity = 101/211 (47.87%), Postives = 119/211 (56.40%), Query Frame = 2
Query:   80 IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFSNLPSSFALKHIIKKLCCNINQP*L**LIDGHANTLTVXXXXXXXXXXXLTDKMTADAALDPSGLVAIAICHGFALFVAVAIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVTGGLAVPTHNXXXXXXXXXXXXXXXXXTFGLVYTVYATAAD 712
            +AFG   DSFS+ S KAY+AEFI+TLLFVFAGVGSAIAF                                                    ++T   ALDP+GLVAIA+ H  ALFV V++ AN SGGH+NPAVTFGLA+GG IT+LTG+FYW+AQLLG+ VA  LL+ VT G A+PTH                  TF LVYTVYATAAD
Sbjct:    4 LAFGSVGDSFSVTSIKAYVAEFIATLLFVFAGVGSAIAFG---------------------------------------------------QLTNGGALDPAGLVAIAVAHALALFVGVSVAANTSGGHLNPAVTFGLAVGGHITVLTGLFYWVAQLLGASVACLLLRFVTHGKAIPTHGVSGGTTELEGVVFEIVITFALVYTVYATAAD 163          
BLAST of CX295107 vs. ExPASy Swiss-Prot
Match: TIP21_ORYSJ (Probable aquaporin TIP2-1 OS=Oryza sativa subsp. japonica GN=TIP2-1 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 5.008e-43
Identity = 104/211 (49.29%), Postives = 119/211 (56.40%), Query Frame = 2
Query:   80 IAFGRFDDSFSLGSFKAYLAEFISTLLFVFAGVGSAIAFSNLPSSFALKHIIKKLCCNINQP*L**LIDGHANTLTVXXXXXXXXXXXLTDKMTADAALDPSGLVAIAICHGFALFVAVAIGANISGGHVNPAVTFGLALGGQITILTGIFYWIAQLLGSIVASFLLKVVTGGLAVPTHNXXXXXXXXXXXXXXXXXTFGLVYTVYATAAD 712
            +AFG   DSFS  S KAY+AEFI+TLLFVFAGVGSAIA+                                                    ++T   ALDP+GLVAIAI H  ALFV V++ ANISGGH+NPAVTFGLA+GG ITILTG+FYWIAQLLG+ +A  LLK VT G A+PTH                  TF LVYTVYATAAD
Sbjct:    4 LAFGSLGDSFSATSVKAYVAEFIATLLFVFAGVGSAIAYG---------------------------------------------------QLTNGGALDPAGLVAIAIAHALALFVGVSVAANISGGHLNPAVTFGLAVGGHITILTGLFYWIAQLLGASIACLLLKFVTHGKAIPTHG-VAGISELEGVVMEIVITFALVYTVYATAAD 162          
The following BLAST results are available for this feature:
BLAST of CX295107 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
TIP21_ARATH1.501e-5557.35Aquaporin TIP2-1 OS=Arabidopsis thaliana GN=TIP2-1... [more]
TIP22_ORYSJ7.214e-5054.50Probable aquaporin TIP2-2 OS=Oryza sativa subsp. j... [more]
TIP2_TOBAC1.231e-4953.55Probable aquaporin TIP-type RB7-18C OS=Nicotiana t... [more]
TIP1_TOBAC1.231e-4953.55Probable aquaporin TIP-type RB7-5A OS=Nicotiana ta... [more]
TIP_ANTMA1.965e-4750.71Probable aquaporin TIP-type OS=Antirrhinum majus G... [more]
TIP22_ARATH5.350e-4549.29Probable aquaporin TIP2-2 OS=Arabidopsis thaliana ... [more]
TIP23_ARATH6.988e-4549.76Aquaporin TIP2-3 OS=Arabidopsis thaliana GN=TIP2-3... [more]
TIP23_MAIZE4.529e-4450.24Aquaporin TIP2-3 OS=Zea mays GN=TIP2-3 PE=2 SV=2[more]
TIP22_MAIZE1.009e-4347.87Aquaporin TIP2-2 OS=Zea mays GN=TIP2-2 PE=2 SV=1[more]
TIP21_ORYSJ5.008e-4349.29Probable aquaporin TIP2-1 OS=Oryza sativa subsp. j... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05068F08SK DroRLeaf1 Citrus clementina cDNA clone C05068F08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295107 ID=CX295107; Name=CX295107; organism=Citrus clementina; type=EST; length=714bp
CTTATCTTCTTCTTCTTAGAAAGACTCGAGAGAGTTTTTTTTTCCCTATT
CTCTAGCTCTTTCTTGATCAACAATGGCTATTGCCTTCGGCCGCTTCGAT
GATTCTTTCAGCTTAGGCTCCTTCAAGGCCTATCTTGCTGAGTTTATCTC
AACTTTGCTCTTTGTTTTCGCCGGCGTTGGCTCGGCCATTGCTTTCAGTA
ATCTTCCATCTTCATTTGCTCTTAAGCACATAATTAAAAAACTTTGTTGT
AACATAAACCAACCCTAATTATGATAACTAATAGATGGCCATGCAAACAC
ATTGACTGTGATTTGATTTTTTTTTTTTATATATTTTTGGTTTTTGACAG
ACAAGATGACAGCAGATGCAGCACTTGATCCATCAGGGCTAGTAGCCATC
GCTATTTGCCATGGATTTGCTCTATTTGTCGCAGTTGCAATTGGTGCTAA
CATCTCAGGTGGCCACGTCAACCCAGCCGTCACCTTTGGATTGGCTCTTG
GTGGCCAAATCACCATCCTCACTGGCATCTTCTACTGGATTGCCCAACTT
CTTGGCTCTATTGTTGCCAGCTTCCTCCTCAAAGTTGTCACTGGAGGCTT
GGCAGTTCCTACCCACAATGTTGCTGCTGGAGTTGGAGCCATTGAAGGAG
TTGTGATGGAGATCATCATCACATTTGGTTTGGTCTACACGGTCTATGCC
ACGGCAGCTGACCC
back to top