CX295119

Overview
NameCX295119
Unique NameCX295119
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length737
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX295119 vs. ExPASy Swiss-Prot
Match: PSB7B_ARATH (Proteasome subunit beta type-7-B OS=Arabidopsis thaliana GN=PBB2 PE=1 SV=2)

HSP 1 Score: 393.66 bits (1010), Expect = 5.593e-109
Identity = 187/219 (85.39%), Postives = 207/219 (94.52%), Query Frame = 2
Query:   80 MSNSAIDVPSRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIFNDLGSGKHVDVCVITK 736
            MS S++D+P +GGFSFDLC+RNDML +KG+  PSF KTGTTIVGLIF+DGVILGADTRATEGPIV DKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQL+LHRY TGR+SRVVTALTLLKKHLF+YQG+V AALVLGGVD TGPHLHTIYPHGSTDTLPFATMGSGSLAAM++FE+KYKEGLT+DEGI+LV +AICSGIFNDLGSG +VD+CVITK
Sbjct:    1 MSQSSVDIPPKGGFSFDLCKRNDMLTQKGLKAPSFLKTGTTIVGLIFKDGVILGADTRATEGPIVADKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLRLHRYQTGRDSRVVTALTLLKKHLFSYQGHVSAALVLGGVDITGPHLHTIYPHGSTDTLPFATMGSGSLAAMSVFEAKYKEGLTRDEGIKLVAEAICSGIFNDLGSGSNVDICVITK 219          
BLAST of CX295119 vs. ExPASy Swiss-Prot
Match: PSB7A_ARATH (Proteasome subunit beta type-7-A OS=Arabidopsis thaliana GN=PBB1 PE=1 SV=2)

HSP 1 Score: 392.119 bits (1006), Expect = 1.627e-108
Identity = 186/219 (84.93%), Postives = 206/219 (94.06%), Query Frame = 2
Query:   80 MSNSAIDVPSRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIFNDLGSGKHVDVCVITK 736
            MS S +DVP +GGFSFDLC+RNDML +KG+  PSF KTGTTIVGLIF+DGVILGADTRATEGPIV DKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQL+LHRY TGR+SRV+TALTLLKKHLF+YQG+V AALVLGGVD TGPHLHTIYPHGSTDTLPFATMGSGSLAAM++FE+KYKEGLT+DEGI+LV ++ICSGIFNDLGSG +VD+CVITK
Sbjct:    1 MSQSTVDVPPKGGFSFDLCKRNDMLTQKGLKAPSFLKTGTTIVGLIFKDGVILGADTRATEGPIVADKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLRLHRYQTGRDSRVITALTLLKKHLFSYQGHVSAALVLGGVDITGPHLHTIYPHGSTDTLPFATMGSGSLAAMSVFEAKYKEGLTRDEGIKLVAESICSGIFNDLGSGSNVDICVITK 219          
BLAST of CX295119 vs. ExPASy Swiss-Prot
Match: PSB7_DICDI (Proteasome subunit beta type-7 OS=Dictyostelium discoideum GN=psmB7 PE=3 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.387e-83
Identity = 143/208 (68.75%), Postives = 177/208 (85.10%), Query Frame = 2
Query:  107 SRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIFNDLGSGKHVDVCVI 730
            +RGGF FDLC RN++L K G+ +  F KTGTTIVG++++ GV+LGADTRATEGPIV DKNCEKIHY+A NIYCCGAGTAADTE+ T ++SS+L+LH+  TG+++RV+TALT+LK+ LF YQG++ AAL+LGG+D  GP LHTIYPHGSTD LP+ TMGSGSLAAMA+FE+KYK  +TK+E I LV +AI SGIFNDLGSG +VDV VI
Sbjct:    5 NRGGFDFDLCNRNNVLEKTGLRMKGFMKTGTTIVGVVYKGGVVLGADTRATEGPIVADKNCEKIHYIADNIYCCGAGTAADTESATALISSKLKLHKLSTGKQTRVITALTMLKQMLFKYQGHISAALILGGIDINGPSLHTIYPHGSTDQLPYVTMGSGSLAAMAVFEAKYKNDMTKEEAIALVAEAISSGIFNDLGSGSNVDVTVI 212          
BLAST of CX295119 vs. ExPASy Swiss-Prot
Match: PSB7_PIG (Proteasome subunit beta type-7 OS=Sus scrofa GN=PSMB7 PE=2 SV=2)

HSP 1 Score: 293.508 bits (750), Expect = 7.878e-79
Identity = 142/222 (63.96%), Postives = 178/222 (80.18%), Query Frame = 2
Query:   89 SAIDVPSR--GGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIFNDLGSGKHVDVCVITK 736
            +A+ V  R  GGFSFD CRRN +L    AKKG  LP+ RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+ TMGSGSLAAMA+FE K++  + ++E  QLV +AI +GIFNDLGSG ++D+CVI+K
Sbjct:    2 AAVSVYERPVGGFSFDNCRRNAILEADFAKKGYKLPTARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPEMEEEEAKQLVSEAIAAGIFNDLGSGSNIDLCVISK 223          
BLAST of CX295119 vs. ExPASy Swiss-Prot
Match: PSB7_MOUSE (Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.344e-78
Identity = 140/223 (62.78%), Postives = 177/223 (79.37%), Query Frame = 2
Query:   80 MSNSAIDVPSRGGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIFNDLGSGKHVDVCVITK 736
            M+  ++  P  GGFSFD CRRN +L    AKKG  LP  RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+ TMGSGSLAAMA+FE K++  + ++E  +LV +AI +GIFNDLGSG ++D+CVI+K
Sbjct:    1 MAAVSVFQPPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISK 223          
BLAST of CX295119 vs. ExPASy Swiss-Prot
Match: PSB7_HUMAN (Proteasome subunit beta type-7 OS=Homo sapiens GN=PSMB7 PE=1 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.344e-78
Identity = 139/223 (62.33%), Postives = 176/223 (78.92%), Query Frame = 2
Query:   80 MSNSAIDVPSRGGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIFNDLGSGKHVDVCVITK 736
            M+  ++  P  GGFSFD CRRN +L    AK+G  LP  RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+ TMGSGSLAAMA+FE K++  + ++E   LV +AI +GIFNDLGSG ++D+CVI+K
Sbjct:    1 MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISK 223          
BLAST of CX295119 vs. ExPASy Swiss-Prot
Match: PSB7_BOVIN (Proteasome subunit beta type-7 OS=Bos taurus GN=PSMB7 PE=1 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 1.755e-78
Identity = 141/222 (63.51%), Postives = 178/222 (80.18%), Query Frame = 2
Query:   89 SAIDVPSR--GGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIFNDLGSGKHVDVCVITK 736
            +A+ V  R  GGFSFD CRRN +L    AKKG  LP+ RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+ TMGSGSLAAMA+FE K++  + ++E  +LV +AI +GIFNDLGSG ++D+CVI+K
Sbjct:    2 AAVSVYERPVGGFSFDNCRRNAVLEADFAKKGYKLPTARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISK 223          
BLAST of CX295119 vs. ExPASy Swiss-Prot
Match: PSB7_RAT (Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 3.910e-78
Identity = 138/212 (65.09%), Postives = 172/212 (81.13%), Query Frame = 2
Query:  113 GGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIFNDLGSGKHVDVCVITK 736
            GGFSFD CRRN +L    AKKG  LP  RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+ TMGSGSLAAMA+FE K++  + ++E  +LV +AI +GIFNDLGSG ++D+CVI+K
Sbjct:   12 GGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISK 223          
BLAST of CX295119 vs. ExPASy Swiss-Prot
Match: PSB7_SCHPO (Probable proteasome subunit beta type-7 OS=Schizosaccharomyces pombe GN=SPAC23D3.07 PE=2 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 6.917e-67
Identity = 121/210 (57.62%), Postives = 160/210 (76.19%), Query Frame = 2
Query:  101 VPSRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIFNDLGSGKHVDVCVI 730
            +  R GF F+  +RN +L +KG   P    TGTTIVG+I +D ++LGADTRAT GPI+ DKNC+K+H ++PNI+C GAGTAADTE VT M+SS ++LH  +T R+ RVVTALT+LK+HLF YQG++ A LVLGG DC GPHL TI  HGS+D LP+  +GSGSLAA+++ E+KY+  L + E ++LV +AI +GIFNDLGSG + D+ VI
Sbjct:    4 INERKGFDFEYYQRNLLLQEKGFPTPKATSTGTTIVGVIAKDCIVLGADTRATAGPIIADKNCKKLHLISPNIWCAGAGTAADTEFVTSMISSNIELHSLYTNRKPRVVTALTMLKQHLFRYQGHIGAYLVLGGYDCKGPHLFTIAAHGSSDKLPYVALGSGSLAAISVLETKYQPDLERHEAMELVKEAIEAGIFNDLGSGSNCDLVVI 213          
BLAST of CX295119 vs. ExPASy Swiss-Prot
Match: PSB10_HUMAN (Proteasome subunit beta type-10 OS=Homo sapiens GN=PSMB10 PE=1 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 8.456e-65
Identity = 118/211 (55.92%), Postives = 155/211 (73.46%), Query Frame = 2
Query:  110 RGGFSFDLCRRNDMLAK--KGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFATMGSGSLAAMAMFESKYKEGLTKDEGIQLVVDAICSGIFNDLGSGKHVDVCVITK 736
            RGGFSF+ C+RN  L +   G+ +P  RKTGTTI GL+FQDGVILGADTRAT   +V DK+CEKIH++AP IYCCGAG AAD E  T MV+S+++LH   TGRE RV T   +L++ LF YQG+V A+L++GGVD TGP L+ ++PHGS   LPF  +GSG  AA+A+ E +++  +T +    L+V+A+ +GI  DLGSG +VD CVITK
Sbjct:    9 RGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITK 219          
The following BLAST results are available for this feature:
BLAST of CX295119 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
PSB7B_ARATH5.593e-10985.39Proteasome subunit beta type-7-B OS=Arabidopsis th... [more]
PSB7A_ARATH1.627e-10884.93Proteasome subunit beta type-7-A OS=Arabidopsis th... [more]
PSB7_DICDI1.387e-8368.75Proteasome subunit beta type-7 OS=Dictyostelium di... [more]
PSB7_PIG7.878e-7963.96Proteasome subunit beta type-7 OS=Sus scrofa GN=PS... [more]
PSB7_MOUSE1.344e-7862.78Proteasome subunit beta type-7 OS=Mus musculus GN=... [more]
PSB7_HUMAN1.344e-7862.33Proteasome subunit beta type-7 OS=Homo sapiens GN=... [more]
PSB7_BOVIN1.755e-7863.51Proteasome subunit beta type-7 OS=Bos taurus GN=PS... [more]
PSB7_RAT3.910e-7865.09Proteasome subunit beta type-7 OS=Rattus norvegicu... [more]
PSB7_SCHPO6.917e-6757.62Probable proteasome subunit beta type-7 OS=Schizos... [more]
PSB10_HUMAN8.456e-6555.92Proteasome subunit beta type-10 OS=Homo sapiens GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05068G08SK DroRLeaf1 Citrus clementina cDNA clone C05068G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295119 ID=CX295119; Name=CX295119; organism=Citrus clementina; type=EST; length=737bp
GAGGGTCGCTGCTGCTCTCCAAAGCTCACGCCTTGTTTTCATTCCAGTGG
GATCAATCTCAGGTTGAAGAAAGTTTAAAATGTCAAACTCTGCAATAGAT
GTTCCTTCCAGGGGTGGATTTAGTTTTGATCTCTGCCGGCGGAATGATAT
GCTTGCAAAGAAGGGTGTCAACCTTCCATCTTTCCGAAAGACGGGGACGA
CCATTGTTGGGTTGATTTTCCAGGATGGCGTCATTCTTGGGGCAGATACC
AGAGCAACTGAAGGACCCATAGTTTGCGATAAGAATTGTGAGAAAATTCA
TTACATGGCTCCAAACATATATTGTTGTGGTGCAGGAACTGCTGCTGACA
CAGAGGCTGTAACTGACATGGTCAGCTCACAGCTGCAGTTACATCGTTAT
CATACTGGTAGAGAGTCAAGGGTTGTTACAGCACTGACTCTTCTCAAGAA
GCACCTTTTCAACTACCAAGGTTATGTGCAAGCTGCTTTGGTTCTTGGTG
GAGTTGATTGCACTGGACCTCATCTTCACACAATATATCCACATGGTTCA
ACTGACACTTTACCATTTGCGACAATGGGTTCTGGTTCTCTTGCTGCCAT
GGCTATGTTTGAATCAAAATACAAAGAAGGCCTGACTAAAGATGAGGGAA
TACAGCTAGTTGTGGACGCCATTTGCTCTGGTATATTCAATGACTTGGGA
AGTGGAAAGCATGTTGATGTCTGTGTAATTACCAAGG
back to top