CX295121

Overview
NameCX295121
Unique NameCX295121
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length723
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX295121 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 331.257 bits (848), Expect = 3.305e-90
Identity = 161/184 (87.50%), Postives = 166/184 (90.22%), Query Frame = 1
Query:    4 AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 555
            AGLSADPETFAKNRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYR+                AFDPLGLADDPD FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIENL+DH+ADPVANNAWAYATNFVPGK
Sbjct:   82 AGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANNAWAYATNFVPGK 265          
BLAST of CX295121 vs. ExPASy Swiss-Prot
Match: CB23_ORYSJ (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. japonica GN=RCABP89 PE=2 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 7.363e-90
Identity = 161/184 (87.50%), Postives = 166/184 (90.22%), Query Frame = 1
Query:    4 AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 555
            AGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENL+DH+ADPVANNAWAYATNFVPGK
Sbjct:   80 AGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK 263          
BLAST of CX295121 vs. ExPASy Swiss-Prot
Match: CB23_ORYSI (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_012078 PE=2 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 7.363e-90
Identity = 161/184 (87.50%), Postives = 166/184 (90.22%), Query Frame = 1
Query:    4 AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 555
            AGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENL+DH+ADPVANNAWAYATNFVPGK
Sbjct:   80 AGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK 263          
BLAST of CX295121 vs. ExPASy Swiss-Prot
Match: CB24_SOLLC (Chlorophyll a-b binding protein 4, chloroplastic OS=Solanum lycopersicum GN=CAB4 PE=2 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 3.093e-88
Identity = 158/184 (85.87%), Postives = 164/184 (89.13%), Query Frame = 1
Query:    4 AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 555
            AGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWACQVVLMGFVEGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIENL DHI DPVANNAWAYATNFVPGK
Sbjct:   82 AGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHINDPVANNAWAYATNFVPGK 265          
BLAST of CX295121 vs. ExPASy Swiss-Prot
Match: CB26_PETSP (Chlorophyll a-b binding protein 37, chloroplastic OS=Petunia sp. GN=CAB37 PE=3 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 9.001e-88
Identity = 157/184 (85.33%), Postives = 164/184 (89.13%), Query Frame = 1
Query:    4 AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 555
            AGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIENLYDH+ADPVANNAWA+ATNFVPGK
Sbjct:   82 AGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAAQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHVADPVANNAWAFATNFVPGK 265          
BLAST of CX295121 vs. ExPASy Swiss-Prot
Match: CB23_TOBAC (Chlorophyll a-b binding protein 36, chloroplastic OS=Nicotiana tabacum GN=CAB36 PE=3 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 2.005e-87
Identity = 155/184 (84.24%), Postives = 164/184 (89.13%), Query Frame = 1
Query:    4 AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 555
            AGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILA+WA QVVLMG +EGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIENL+DH+ADPVANNAWAYATNFVPGK
Sbjct:   82 AGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAVWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK 265          
BLAST of CX295121 vs. ExPASy Swiss-Prot
Match: CB215_PEA (Chlorophyll a-b binding protein 215, chloroplastic OS=Pisum sativum GN=CAB215 PE=1 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 2.005e-87
Identity = 155/184 (84.24%), Postives = 164/184 (89.13%), Query Frame = 1
Query:    4 AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 555
            AGLSADPETFA+NRELEVIHSRWAMLGALGC FPE+L KNGVKFGEAVWFKAG+QIF+EGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI+NLYDH+ADPVANNAWA+ATNFVPG+
Sbjct:   82 AGLSADPETFARNRELEVIHSRWAMLGALGCTFPELLEKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPDSFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQNLYDHVADPVANNAWAFATNFVPGQ 265          
BLAST of CX295121 vs. ExPASy Swiss-Prot
Match: CB25_SOLLC (Chlorophyll a-b binding protein 5, chloroplastic (Fragment) OS=Solanum lycopersicum GN=CAB5 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 3.420e-87
Identity = 158/184 (85.87%), Postives = 163/184 (88.59%), Query Frame = 1
Query:    4 AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 555
            AGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIENL DHIADPVANNAWAYATNFVPGK
Sbjct:   54 AGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHIADPVANNAWAYATNFVPGK 237          
BLAST of CX295121 vs. ExPASy Swiss-Prot
Match: CB21_LEMGI (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Lemna gibba PE=3 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 5.834e-87
Identity = 155/184 (84.24%), Postives = 164/184 (89.13%), Query Frame = 1
Query:    4 AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 555
            AGLSADPETFAKNRELEVIHSRWAMLGALGC+FPE+LSKNGV+FGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIENL DHIADPVANNAWA+ATNFVPGK
Sbjct:   81 AGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSKNGVQFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGLIEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHIADPVANNAWAFATNFVPGK 264          
BLAST of CX295121 vs. ExPASy Swiss-Prot
Match: CB21_CUCSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 1.300e-86
Identity = 155/184 (84.24%), Postives = 164/184 (89.13%), Query Frame = 1
Query:    4 AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 555
            AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWACQVVLMG VEGYRI                +FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct:   72 AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 255          
The following BLAST results are available for this feature:
BLAST of CX295121 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
CB21_GOSHI3.305e-9087.50Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB23_ORYSJ7.363e-9087.50Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB23_ORYSI7.363e-9087.50Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB24_SOLLC3.093e-8885.87Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB26_PETSP9.001e-8885.33Chlorophyll a-b binding protein 37, chloroplastic ... [more]
CB23_TOBAC2.005e-8784.24Chlorophyll a-b binding protein 36, chloroplastic ... [more]
CB215_PEA2.005e-8784.24Chlorophyll a-b binding protein 215, chloroplastic... [more]
CB25_SOLLC3.420e-8785.87Chlorophyll a-b binding protein 5, chloroplastic (... [more]
CB21_LEMGI5.834e-8784.24Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB21_CUCSA1.300e-8684.24Chlorophyll a-b binding protein of LHCII type I, c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05068G10SK DroRLeaf1 Citrus clementina cDNA clone C05068G10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295121 ID=CX295121; Name=CX295121; organism=Citrus clementina; type=EST; length=723bp
GAGGCTGGTTTATCAGCAGACCCCGAGACATTTGCTAAGAACCGTGAGCT
AGAGGTGATCCACAGCAGATGGGCAATGCTTGGAGCTCTTGGCTGCGTCT
TCCCTGAAATCCTCTCCAAGAATGGAGTGAAGTTCGGCGAAGCAGTTTGG
TTCAAGGCTGGCGCTCAAATCTTCTCTGAAGGTGGCCTTGACTATCTTGG
CAACCCCAACCTCATTCATGCTCAGAGCATTTTGGCTATCTGGGCCTGCC
AGGTTGTGCTCATGGGTTTTGTTGAAGGATACAGAATTGGTGGCGGTCCT
CTTGGTGAAGGACTTGACCCACTTTACCCTGGTGGTGCTTTTGACCCACT
TGGTTTGGCTGATGACCCCGATCAATTTGCTGAGTTGAAGGTCAAGGAGC
TCAAGAATGGCCGTCTGGCTATGTTCTCCATGTTTGGATTCTTTGTTCAG
GCTATTGTCACTGGGAAGGGTCCAATTGAGAACCTCTACGACCACATTGC
TGATCCTGTGGCCAACAATGCCTGGGCTTATGCCACTAACTTTGTTCCCG
GAAAGTGAAGAAACTCATGACTTGATGGTGTCTGTTTCATCTGTAACATT
ATTCTATCTATCGTATGTGCTTTTGTGGAAAACTCTGTCATGGACTTACT
AGTAGCTCTGTAATGTTACCATTAGAAATGCTATGCTCCTGATCTTTTAT
TTCATCAGAAAAAAAAAAAAAAA
back to top