CX295160

Overview
NameCX295160
Unique NameCX295160
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length715
Libraries
Library NameType
PhIFruit1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig619 contig Ccv1_Contig619:1..715. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX295160 vs. ExPASy Swiss-Prot
Match: IPYR1_ARATH (Soluble inorganic pyrophosphatase 1, chloroplastic OS=Arabidopsis thaliana GN=PPA1 PE=1 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 7.189e-90
Identity = 159/213 (74.65%), Postives = 177/213 (83.10%), Query Frame = 1
Query:   85 ISQTTSCLLSKTPFALKHKSH---ITNLCFGTKGVAFPSKRLFSCRAIYNPQVQITEEGQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRYYPYNINWNYGLFPQTWEDPSFANSEVEGAFGDNDPVDVVEIGERRRKIGEILRVKPLSALAMIDEGELDWKIVAISLDDPRLPL 714
            ++QTTSC L+K  F L  K        LCF  + +   SKR FSC AIYNPQV++ EEG  E+LDYRVFF++ SGKKVSPWHDIPL LGDGVFNF+VEIPKES AKMEVATDE +TPIKQD KKGKLRYYPYNINWNYGL PQTWEDPS ANSEVEG FGDNDPVDVVEIGE +RKIG+IL++KPL+ALAMIDEGELDWKIVAISLDDP+  L
Sbjct:   13 VTQTTSCFLAKQAFTLPAKKSCGGFGGLCFSRRALVLKSKRPFSCSAIYNPQVKVQEEGPAESLDYRVFFLDGSGKKVSPWHDIPLTLGDGVFNFIVEIPKESKAKMEVATDEDFTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPSHANSEVEGCFGDNDPVDVVEIGETQRKIGDILKIKPLAALAMIDEGELDWKIVAISLDDPKAHL 225          
BLAST of CX295160 vs. ExPASy Swiss-Prot
Match: IPYR1_CHLRE (Soluble inorganic pyrophosphatase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=ppa1 PE=1 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.853e-54
Identity = 99/159 (62.26%), Postives = 124/159 (77.99%), Query Frame = 1
Query:  238 ITEEGQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRYYPYNINWNYGLFPQTWEDPSFANSEVEGAFGDNDPVDVVEIGERRRKIGEILRVKPLSALAMIDEGELDWKIVAISLDDPRLPL 714
            + E+G  ++L+YR+FF     K+VS WH+IPL  GDG  +++ EIPKE+SAKMEVATDE  TPIKQD+KKGKLR+YPYNINWNYG+ PQTWEDP   ++ + GA GDNDPVDVVEIG    K G + +VKP+  LAMID+GELDWK++AIS DDP+  L
Sbjct:   48 VEEKGPKDSLEYRMFF-KQGAKEVSCWHEIPLYAGDGHLHYICEIPKETSAKMEVATDEPRTPIKQDVKKGKLRFYPYNINWNYGMLPQTWEDPGHTDATL-GAAGDNDPVDVVEIGAAAAKRGGVYKVKPVGVLAMIDDGELDWKVIAISADDPKAAL 204          
BLAST of CX295160 vs. ExPASy Swiss-Prot
Match: IPYR_MOUSE (Inorganic pyrophosphatase OS=Mus musculus GN=Ppa1 PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 4.566e-44
Identity = 87/158 (55.06%), Postives = 110/158 (69.62%), Query Frame = 1
Query:  244 EEGQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPY-NINWNYGLFPQTWEDPSFANSEVEGAFGDNDPVDVVEIGERRRKIGEILRVKPLSALAMIDEGELDWKIVAISLDDP 702
            E   P TL+YRVF  N  G+ +SP+HD+P+     VF+ VVE+P+ S+AKME+AT +   PIKQD+KKGKLRY    +PY    WNYG  PQTWEDP  ++    G  GDNDP+DV EIG +    GEI+RVK L  LAMIDEGE DWK++AI++DDP
Sbjct:    8 ERAAPFTLEYRVFLKNEKGQYISPFHDVPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHSDKHT-GCCGDNDPIDVCEIGSKVCARGEIIRVKVLGILAMIDEGETDWKVIAINVDDP 164          
BLAST of CX295160 vs. ExPASy Swiss-Prot
Match: IPYR_BOVIN (Inorganic pyrophosphatase OS=Bos taurus GN=PPA1 PE=1 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 1.017e-43
Identity = 88/158 (55.70%), Postives = 110/158 (69.62%), Query Frame = 1
Query:  244 EEGQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPY-NINWNYGLFPQTWEDPSFANSEVEGAFGDNDPVDVVEIGERRRKIGEILRVKPLSALAMIDEGELDWKIVAISLDDP 702
            E   P TL+YRVF  N  G+ +SP+HDIP+     VF+ VVE+P+ S+AKME+AT +   PIKQD+KKGKLRY    +PY    WNYG  PQTWEDP   N +  G  GDNDP+DV EIG +    GEI+RVK L  LAMIDEGE DWK++AI+++DP
Sbjct:    8 ERAAPFTLEYRVFLKNEKGQYISPFHDIPIYADKEVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGH-NDKHTGCCGDNDPIDVCEIGSKVCARGEIIRVKVLGILAMIDEGETDWKVIAINVEDP 164          
BLAST of CX295160 vs. ExPASy Swiss-Prot
Match: IPYR_MACFA (Inorganic pyrophosphatase OS=Macaca fascicularis GN=PPA1 PE=2 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 5.048e-43
Identity = 87/158 (55.06%), Postives = 109/158 (68.99%), Query Frame = 1
Query:  244 EEGQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPY-NINWNYGLFPQTWEDPSFANSEVEGAFGDNDPVDVVEIGERRRKIGEILRVKPLSALAMIDEGELDWKIVAISLDDP 702
            E   P +L+YRVF  N  G+ +SP+HDIP+     VF+ VVE+P+ S+AKME+AT +   PIKQD+KKGKLRY    +PY    WNYG  PQTWEDP   N +  G  GDNDP+DV EIG +    GEI+ VK L  LAMIDEGE DWK++AI++DDP
Sbjct:    8 ERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGH-NDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDP 164          
BLAST of CX295160 vs. ExPASy Swiss-Prot
Match: IPYR_HUMAN (Inorganic pyrophosphatase OS=Homo sapiens GN=PPA1 PE=1 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 5.048e-43
Identity = 87/158 (55.06%), Postives = 109/158 (68.99%), Query Frame = 1
Query:  244 EEGQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPY-NINWNYGLFPQTWEDPSFANSEVEGAFGDNDPVDVVEIGERRRKIGEILRVKPLSALAMIDEGELDWKIVAISLDDP 702
            E   P +L+YRVF  N  G+ +SP+HDIP+     VF+ VVE+P+ S+AKME+AT +   PIKQD+KKGKLRY    +PY    WNYG  PQTWEDP   N +  G  GDNDP+DV EIG +    GEI+ VK L  LAMIDEGE DWK++AI++DDP
Sbjct:    8 ERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGH-NDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDP 164          
BLAST of CX295160 vs. ExPASy Swiss-Prot
Match: IPYR_PONAB (Inorganic pyrophosphatase OS=Pongo abelii GN=PPA1 PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.272e-42
Identity = 86/158 (54.43%), Postives = 108/158 (68.35%), Query Frame = 1
Query:  244 EEGQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPY-NINWNYGLFPQTWEDPSFANSEVEGAFGDNDPVDVVEIGERRRKIGEILRVKPLSALAMIDEGELDWKIVAISLDDP 702
            E   P +L+YRVF  N  G+ +SP+HDIP+     VF+ VVE+P+ S+AKME+AT +   PIKQD+KK KLRY    +PY    WNYG  PQTWEDP   N +  G  GDNDP+DV EIG +    GEI+ VK L  LAMIDEGE DWK++AI++DDP
Sbjct:    8 ERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKRKLRYVANLFPYKGYIWNYGAIPQTWEDPGH-NDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINMDDP 164          
BLAST of CX295160 vs. ExPASy Swiss-Prot
Match: IPYR2_HUMAN (Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens GN=PPA2 PE=1 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 1.287e-38
Identity = 83/175 (47.43%), Postives = 110/175 (62.86%), Query Frame = 1
Query:  244 EEGQPETLDYRVFFVNNSGKKVSPWHDIPLQLG-----------------DGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPYN-INWNYGLFPQTWEDPSFANSEVEGAFGDNDPVDVVEIGERRRKIGEILRVKPLSALAMIDEGELDWKIVAISLDDP 702
            E GQP + +YR+FF N +G  +SP+HDIPL++                  + +FN +VEIP+ ++AKME+AT E   PIKQ +K GKLRY    +PY    WNYG  PQTWEDP   +      FGDNDP+DV EIG +    GE++ VK L  LA+IDEGE DWK++AI+ +DP
Sbjct:   39 ERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEENGIPMKKARNDEYENLFNMIVEIPRWTNAKMEIATKEPMNPIKQYVKDGKLRYVANIFPYKGYIWNYGTLPQTWEDPHEKDKSTN-CFGDNDPIDVCEIGSKILSCGEVIHVKILGILALIDEGETDWKLIAINANDP 212          
BLAST of CX295160 vs. ExPASy Swiss-Prot
Match: IPYR_ASHGO (Inorganic pyrophosphatase OS=Ashbya gossypii GN=IPP1 PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.195e-38
Identity = 83/161 (51.55%), Postives = 111/161 (68.94%), Query Frame = 1
Query:  250 GQPETLDYRVFFVNNSGKKVSPWHDIPLQLGDG--VFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPYN-INWNYGLFPQTWEDPSFANSEVEGAFGDNDPVDVVEIGERRRKIGEILRVKPLSALAMIDEGELDWKIVAISLDDPRLP 711
            G   TLDYRVF +  +GK VSP+HDIPL   +   +FN VVEIP+ ++AK+E+  +E   PI QD KKGKLRY    +P++    NYG FPQTWEDP+ A+ E + A+GDNDP+DV+EIGE     G++ +VK L  +A++DEGE DWKI+ I + DP  P
Sbjct:    9 GAKNTLDYRVF-IEKAGKVVSPFHDIPLYADEENQIFNMVVEIPRWTNAKLEITKEEAMNPIIQDTKKGKLRYVRNCFPHHGYIHNYGAFPQTWEDPNVAHPETK-AYGDNDPLDVLEIGETIAYTGQVKQVKVLGVMALLDEGETDWKIIVIDVHDPLAP 167          
BLAST of CX295160 vs. ExPASy Swiss-Prot
Match: IPYR_CANGA (Inorganic pyrophosphatase OS=Candida glabrata GN=IPP1 PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 6.386e-38
Identity = 82/161 (50.93%), Postives = 110/161 (68.32%), Query Frame = 1
Query:  250 GQPETLDYRVFFVNNSGKKVSPWHDIPLQLG--DGVFNFVVEIPKESSAKMEVATDELYTPIKQDIKKGKLRY----YPYN-INWNYGLFPQTWEDPSFANSEVEGAFGDNDPVDVVEIGERRRKIGEILRVKPLSALAMIDEGELDWKIVAISLDDPRLP 711
            G   TLDY+VF +   GK VSP+HDIPL     + +FN VVEIP+ ++AK+E+  +E   PI QD KKGKLRY    +P++    NYG FPQTWEDP+  + E + A GDNDPVDV+EIGE     G++ +VK L  +A++DEGE DWK++AI ++DP  P
Sbjct:    9 GAKNTLDYKVF-IEEDGKPVSPFHDIPLYADKEENIFNMVVEIPRWTNAKLEITKEETLNPIIQDTKKGKLRYVRNCFPHHGYIHNYGAFPQTWEDPNQTHPETK-AVGDNDPVDVLEIGETIGYTGQVKQVKVLGIMALLDEGETDWKVIAIDINDPLAP 167          
The following BLAST results are available for this feature:
BLAST of CX295160 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
IPYR1_ARATH7.189e-9074.65Soluble inorganic pyrophosphatase 1, chloroplastic... [more]
IPYR1_CHLRE2.853e-5462.26Soluble inorganic pyrophosphatase 1, chloroplastic... [more]
IPYR_MOUSE4.566e-4455.06Inorganic pyrophosphatase OS=Mus musculus GN=Ppa1 ... [more]
IPYR_BOVIN1.017e-4355.70Inorganic pyrophosphatase OS=Bos taurus GN=PPA1 PE... [more]
IPYR_MACFA5.048e-4355.06Inorganic pyrophosphatase OS=Macaca fascicularis G... [more]
IPYR_HUMAN5.048e-4355.06Inorganic pyrophosphatase OS=Homo sapiens GN=PPA1 ... [more]
IPYR_PONAB3.272e-4254.43Inorganic pyrophosphatase OS=Pongo abelii GN=PPA1 ... [more]
IPYR2_HUMAN1.287e-3847.43Inorganic pyrophosphatase 2, mitochondrial OS=Homo... [more]
IPYR_ASHGO2.195e-3851.55Inorganic pyrophosphatase OS=Ashbya gossypii GN=IP... [more]
IPYR_CANGA6.386e-3850.93Inorganic pyrophosphatase OS=Candida glabrata GN=I... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05069C01SK PhIFruit1 Citrus clementina cDNA clone C05069C01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295160 ID=CX295160|Name=CX295160|organism=Citrus clementina|type=EST|length=715bp
GAGGCAATCTCCAAAACTCATTCCACTTTCTCACTCACTCCCACTCACAG
TCGCCAGTCAGCAGCCATGGCAGCCGCAAAAGCGATAAGCCAAACCACTT
CTTGCTTGCTGTCCAAAACACCCTTTGCTCTGAAACACAAATCCCACATC
ACAAATCTTTGCTTTGGTACCAAAGGAGTTGCTTTTCCGTCAAAGAGGCT
GTTTTCATGTAGGGCTATTTATAATCCTCAGGTTCAAATCACAGAGGAGG
GCCAGCCTGAAACTCTAGATTACAGAGTCTTTTTCGTCAACAATTCTGGC
AAAAAGGTTTCTCCCTGGCATGACATACCGCTGCAATTGGGTGACGGTGT
TTTCAACTTTGTTGTTGAAATACCCAAAGAATCAAGTGCAAAGATGGAGG
TTGCTACTGATGAGCTATACACCCCTATTAAACAGGATATAAAGAAGGGG
AAGCTTCGATACTACCCATACAACATAAATTGGAATTATGGATTGTTTCC
ACAAACATGGGAAGATCCATCTTTTGCAAACTCTGAAGTTGAAGGGGCAT
TTGGGGATAATGATCCAGTTGATGTTGTTGAGATTGGTGAAAGAAGGAGA
AAGATTGGTGAAATTCTTAGGGTCAAGCCCTTGAGTGCCTTAGCCATGAT
TGATGAAGGTGAACTTGACTGGAAAATAGTGGCAATTTCATTGGATGATC
CAAGGCTGCCCTTGT
back to top