CX295170

Overview
NameCX295170
Unique NameCX295170
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length712
Libraries
Library NameType
PhIFruit1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig146 contig Ccv1_Contig146:203..915. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX295170 vs. ExPASy Swiss-Prot
Match: SDL5A_SOYBN (Dynamin-related protein 5A OS=Glycine max PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 5.288e-85
Identity = 156/184 (84.78%), Postives = 168/184 (91.30%), Query Frame = 1
Query:    1 DSAEGFTEGTGSKAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQDVDKGGNPTHSIFDRYNDSYLRRIGTTVLSYVNMVCASLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEQKRLSNLLNEDPAVMERRSALAKRLELYRSAQSEIDAVAWSK 552
            D+     +    KAISET +LKQYP LR EVG AA++SLERMRD SK+ATLQLVDMEC YLTVDFFRKLPQDVDKGGNPTHSIFDRYNDSYLRRIGTT+LSYVNMVCA+LRNSIPKSIVYCQVREAKRSLLDHFFTELGK+E KRLS+LLNEDPA+MERRSALAKRLELYRSAQ+EIDAVAWSK
Sbjct:  427 DAVHSLLKDLVHKAISETLDLKQYPGLRVEVGAAAVDSLERMRDESKRATLQLVDMECGYLTVDFFRKLPQDVDKGGNPTHSIFDRYNDSYLRRIGTTILSYVNMVCATLRNSIPKSIVYCQVREAKRSLLDHFFTELGKMETKRLSSLLNEDPAIMERRSALAKRLELYRSAQAEIDAVAWSK 610          
BLAST of CX295170 vs. ExPASy Swiss-Prot
Match: SDLCA_SOYBN (Dynamin-related protein 12A OS=Glycine max PE=1 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.440e-82
Identity = 152/184 (82.61%), Postives = 167/184 (90.76%), Query Frame = 1
Query:    1 DSAEGFTEGTGSKAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQDVDKGGNPTHSIFDRYNDSYLRRIGTTVLSYVNMVCASLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEQKRLSNLLNEDPAVMERRSALAKRLELYRSAQSEIDAVAWSK 552
            D+     +    KA+SET +LKQYP LR EVG A+++SLERMRD SK+ATLQLVDMEC YLTVDFFRKLPQDVDKGGNPTHSI DRYNDSYLRRIGTT+LSYVNMVCA+LR+SIPKSIVYCQVREAKRSLLDHFFTELGK+E KRLS+LLNEDPA+MERRSALAKRLELYRSAQ+EIDAVAWSK
Sbjct:  427 DAVHSLLKDLVHKAMSETLDLKQYPGLRVEVGAASVDSLERMRDESKRATLQLVDMECGYLTVDFFRKLPQDVDKGGNPTHSICDRYNDSYLRRIGTTILSYVNMVCATLRHSIPKSIVYCQVREAKRSLLDHFFTELGKMEIKRLSSLLNEDPAIMERRSALAKRLELYRSAQAEIDAVAWSK 610          
BLAST of CX295170 vs. ExPASy Swiss-Prot
Match: DRP1A_ARATH (Dynamin-related protein 1A OS=Arabidopsis thaliana GN=DRP1A PE=1 SV=3)

HSP 1 Score: 302.368 bits (773), Expect = 1.592e-81
Identity = 149/184 (80.98%), Postives = 166/184 (90.22%), Query Frame = 1
Query:    1 DSAEGFTEGTGSKAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQDVDKGGNPTHSIFDRYNDSYLRRIGTTVLSYVNMVCASLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEQKRLSNLLNEDPAVMERRSALAKRLELYRSAQSEIDAVAWSK 552
            D+     +    K+++ET ELKQYPALR EV NAAIESL++MR+ SKKATLQLVDMECSYLTVDFFRKLPQDV+KGGNPTHSIFDRYNDSYLRRIG+ VLSYVNMVCA LRNSIPKSIVYCQVREAKRSLLDHFF ELG ++ KRLS+LLNEDPA+MERRSA++KRLELYR+AQSEIDAVAWSK
Sbjct:  427 DTVHAILKDLVHKSVNETVELKQYPALRVEVTNAAIESLDKMREGSKKATLQLVDMECSYLTVDFFRKLPQDVEKGGNPTHSIFDRYNDSYLRRIGSNVLSYVNMVCAGLRNSIPKSIVYCQVREAKRSLLDHFFAELGTMDMKRLSSLLNEDPAIMERRSAISKRLELYRAAQSEIDAVAWSK 610          
BLAST of CX295170 vs. ExPASy Swiss-Prot
Match: DRP1B_ARATH (Dynamin-related protein 1B OS=Arabidopsis thaliana GN=DRP1B PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 3.010e-72
Identity = 133/172 (77.33%), Postives = 153/172 (88.95%), Query Frame = 1
Query:   37 KAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQDVDKGGNPTHSIFDRYNDSYLRRIGTTVLSYVNMVCASLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEQKRLSNLLNEDPAVMERRSALAKRLELYRSAQSEIDAVAWSK 552
            K++ ET ELKQYP LR EV  AA++SL+RMRD S+KATL LVDME  YLTV+FFRKLPQD +KGGNPTHSIFDRYND+YLRRIG+ VLSYVNMVCA LRNSIPKSIVYCQVREAKRSLLD FFTELG+ E  +LS LL+EDPAV +RR+++AKRLELYRSAQ++I+AVAWSK
Sbjct:  439 KSMGETSELKQYPTLRVEVSGAAVDSLDRMRDESRKATLLLVDMESGYLTVEFFRKLPQDSEKGGNPTHSIFDRYNDAYLRRIGSNVLSYVNMVCAGLRNSIPKSIVYCQVREAKRSLLDIFFTELGQKEMSKLSKLLDEDPAVQQRRTSIAKRLELYRSAQTDIEAVAWSK 610          
BLAST of CX295170 vs. ExPASy Swiss-Prot
Match: DRP1C_ARATH (Dynamin-related protein 1C OS=Arabidopsis thaliana GN=DRP1C PE=1 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 3.580e-49
Identity = 97/174 (55.75%), Postives = 136/174 (78.16%), Query Frame = 1
Query:   37 KAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQDVDKGG-NPTHSIF---DRYNDSYLRRIGTTVLSYVNMVCASLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEQKRLSNLLNEDPAVMERRSALAKRLELYRSAQSEIDAVAW 546
            K+ISET ELK++P L +++  AA E+LER RD S+K  L+LVDME SYLTV+FFRKL  + +K   NP ++     D Y+D++ R+IG+ V +Y+NMVC +LRNS+PK++VYCQVREAKRSLL+ F+ ++G+ E+++L  +L+EDP +MERR  LAKRLELY+ A+ +IDAVAW
Sbjct:  440 KSISETEELKRFPTLASDIAAAANEALERFRDESRKTVLRLVDMESSYLTVEFFRKLHLEPEKEKPNPRNAPAPNADPYSDNHFRKIGSNVSAYINMVCDTLRNSLPKAVVYCQVREAKRSLLNFFYAQVGRKEKEKLGAMLDEDPQLMERRGTLAKRLELYKQARDDIDAVAW 613          
BLAST of CX295170 vs. ExPASy Swiss-Prot
Match: DRP1E_ARATH (Dynamin-related protein 1E OS=Arabidopsis thaliana GN=DRP1E PE=1 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 6.752e-48
Identity = 93/178 (52.25%), Postives = 134/178 (75.28%), Query Frame = 1
Query:   37 KAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQDVDKG--------GNPTHSIFDRYNDSYLRRIGTTVLSYVNMVCASLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEQKRLSNLLNEDPAVMERRSALAKRLELYRSAQSEIDAVAW 546
            K+ISET ELK++P+L+ E+  AA  SLE+ R+ SKK+ ++LVDME +YLT +FFRKLPQ++++          +P+ +  D+Y D + RRI + V +YVNMV  +LRN+IPK+ VYCQVR+AK +LL++F++++ K E K+L  LL+EDPA+M+RR   AKRLELY+ A+ EIDAVAW
Sbjct:  445 KSISETEELKRFPSLQVELAAAANSSLEKFREESKKSVIRLVDMESAYLTAEFFRKLPQEIERPVTNSKNQTASPSSATLDQYGDGHFRRIASNVSAYVNMVSDTLRNTIPKACVYCQVRQAKLALLNYFYSQISKREGKQLGQLLDEDPALMDRRLECAKRLELYKKARDEIDAVAW 622          
BLAST of CX295170 vs. ExPASy Swiss-Prot
Match: DRP1D_ARATH (Dynamin-related protein 1D OS=Arabidopsis thaliana GN=DRP1D PE=2 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 3.246e-42
Identity = 88/172 (51.16%), Postives = 126/172 (73.26%), Query Frame = 1
Query:   37 KAISETPELKQYPALRAEVGNAAIESLERMRDTSKKATLQLVDMECSYLTVDFFRKLPQDVDKGG--NPTHSIFDRYNDSYLRRIGTTVLSYVNMVCASLRNSIPKSIVYCQVREAKRSLLDHFFTELGKLEQKRLSNLLNEDPAVMERRSALAKRLELYRSAQSEIDAVAW 546
            KAI+ET ELK++P+L+ E+  AA  SL++ R+ S K+ L+LVDME SYLTVDFFRKL  +       +PT +I D+Y D + R+I + V +Y+ MV  +L N+IPK++V+CQVR+AK SLL++F+ ++ + + KRL  LL+E+PA+MERR   AKRLELY+ A+ EIDA  W
Sbjct:  440 KAIAETEELKRFPSLQIELVAAANSSLDKFREESMKSVLRLVDMESSYLTVDFFRKLHVESQNMSLSSPTSAI-DQYGDGHFRKIASNVAAYIKMVAETLVNTIPKAVVHCQVRQAKLSLLNYFYAQISQSQGKRLGQLLDENPALMERRMQCAKRLELYKKARDEIDAAVW 610          
The following BLAST results are available for this feature:
BLAST of CX295170 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
SDL5A_SOYBN5.288e-8584.78Dynamin-related protein 5A OS=Glycine max PE=2 SV=... [more]
SDLCA_SOYBN1.440e-8282.61Dynamin-related protein 12A OS=Glycine max PE=1 SV... [more]
DRP1A_ARATH1.592e-8180.98Dynamin-related protein 1A OS=Arabidopsis thaliana... [more]
DRP1B_ARATH3.010e-7277.33Dynamin-related protein 1B OS=Arabidopsis thaliana... [more]
DRP1C_ARATH3.580e-4955.75Dynamin-related protein 1C OS=Arabidopsis thaliana... [more]
DRP1E_ARATH6.752e-4852.25Dynamin-related protein 1E OS=Arabidopsis thaliana... [more]
DRP1D_ARATH3.246e-4251.16Dynamin-related protein 1D OS=Arabidopsis thaliana... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05069C11SK PhIFruit1 Citrus clementina cDNA clone C05069C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295170 ID=CX295170|Name=CX295170|organism=Citrus clementina|type=EST|length=712bp
GATTCGGCCGAGGGCTTTACTGAAGGAACTGGTTCCAAGGCCATCAGTGA
AACCCCTGAATTAAAGCAGTATCCTGCTCTCCGAGCAGAAGTTGGAAATG
CAGCTATCGAGTCTCTTGAGAGAATGAGGGACACAAGCAAAAAAGCTACA
CTTCAGCTTGTTGATATGGAGTGCAGTTATCTGACAGTTGATTTCTTCCG
GAAGCTTCCTCAGGATGTTGACAAGGGTGGCAATCCTACACATTCAATTT
TTGACAGATACAATGATTCGTATCTAAGGAGAATTGGAACCACGGTCTTG
TCTTATGTCAATATGGTCTGTGCAAGTCTGCGGAACTCAATTCCTAAGTC
CATCGTTTATTGTCAAGTTCGTGAGGCCAAACGAAGCCTACTTGATCATT
TCTTCACTGAATTGGGTAAATTGGAGCAAAAACGATTGTCAAACCTGTTG
AATGAAGATCCGGCAGTCATGGAGCGACGATCTGCCCTTGCAAAAAGGTT
GGAGTTATACAGGAGTGCACAATCAGAAATTGATGCAGTTGCTTGGTCAA
AGTAGTTCAACATTTTACCAGTCCATTTCAGCTCACGAATTTTGGCTTGA
TGGTGACTGTCATTCTTTCAATTATGACTAGCCATGCAGGGGAGAAAGCG
GCGGGATATTTCATTATATTTCTATACCCTAACTAGTAGTCAGGGTGTGA
TTAGGCATATTT
back to top