CX295190
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX295190 vs. ExPASy Swiss-Prot
Match: PLSP1_ARATH (Chloroplast processing peptidase OS=Arabidopsis thaliana GN=PLSP1 PE=2 SV=2) HSP 1 Score: 110.153 bits (274), Expect = 9.889e-24 Identity = 51/61 (83.61%), Postives = 57/61 (93.44%), Query Frame = 3 Query: 468 QVTYYFRKPCSNDIVIFKSPPVLQEVGYTDDDVFIKRVVAKEGDVVEVREGKLIVNGVVRN 650 +V+YYFRKPC+NDIVIFKSPPVLQEVGYTD DVFIKR+VAKEGD+VEV GKL+VNGV RN Sbjct: 157 KVSYYFRKPCANDIVIFKSPPVLQEVGYTDADVFIKRIVAKEGDLVEVHNGKLMVNGVARN 217
BLAST of CX295190 vs. ExPASy Swiss-Prot
Match: TPP1_ARATH (Thylakoidal processing peptidase 1, chloroplastic OS=Arabidopsis thaliana GN=TPP1 PE=2 SV=2) HSP 1 Score: 80.1073 bits (196), Expect = 1.096e-14 Identity = 39/63 (61.90%), Postives = 51/63 (80.95%), Query Frame = 3 Query: 468 QVTYYFRKPCSNDIVIFKSPPVL---QEVGYTDDDVFIKRVVAKEGDVVEVREGKLIVNGVVR 647 +V+Y+FRKP +DIVIFK+PP+L E GY+ +DVFIKR+VA EGD VEVR+GKL VN +V+ Sbjct: 199 KVSYFFRKPEVSDIVIFKAPPILLEYPEYGYSSNDVFIKRIVASEGDWVEVRDGKLFVNDIVQ 261
BLAST of CX295190 vs. ExPASy Swiss-Prot
Match: TPP2_ARATH (Probable thylakoidal processing peptidase 2, chloroplastic OS=Arabidopsis thaliana GN=TPP2 PE=2 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 3.189e-14 Identity = 38/60 (63.33%), Postives = 49/60 (81.67%), Query Frame = 3 Query: 468 QVTYYFRKPCSNDIVIFKSPPVLQEVGYTDDDVFIKRVVAKEGDVVEVREGKLIVNGVVR 647 +V+Y+FRKP +DIVIFK+PP+L E GY+ DVFIKR+VA EGD VEV +GKL+VN V+ Sbjct: 229 KVSYFFRKPEVSDIVIFKAPPILVEHGYSCADVFIKRIVASEGDWVEVCDGKLLVNDTVQ 288 The following BLAST results are available for this feature:
BLAST of CX295190 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX295190 ID=CX295190; Name=CX295190; organism=Citrus clementina; type=EST; length=650bpback to top |