CX295705

Overview
NameCX295705
Unique NameCX295705
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length710
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX295705 vs. ExPASy Swiss-Prot
Match: Y5175_ARATH (UPF0706 protein At5g01750 OS=Arabidopsis thaliana GN=At5g01750 PE=1 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 6.522e-67
Identity = 114/184 (61.96%), Postives = 151/184 (82.07%), Query Frame = 1
Query:  145 VIGPQYCLPYPVDLSIVRKFLTLTDGSFAVTDINDNLMFKVKEKLISLHDKRTLLDPAGNPIVTITEKVFSLHEKHFVFRGASTDTKDLLFTVERSSVIQLKTTLNVYLASNTKQDVCDFKIKGSWTEKSCVVYAGESNTIVAQMHKKTTAGSVLLNKDRFTVTVYPNIDYAFIVALIVILDDI 696
            V+ P+YC PYP+D++IVRK ++LTDG+F +TD+N NL+FKVKE +  LHDKR LLD +G P+VT+ EK+ S+H++  VFRG STD +DLL+TV+RSS++QLKT L+V+L  N  +  CDF++KGSW E+SCVVYAGES+ IVAQMH+K T  SV L KD F+VTVYPN+DYAFI +L+VILDD+
Sbjct:   27 VVDPKYCAPYPIDMAIVRKMMSLTDGNFVITDVNGNLLFKVKEPVFGLHDKRVLLDGSGTPVVTLREKMVSMHDRWQVFRGGSTDQRDLLYTVKRSSMLQLKTKLDVFLGHNKDEKRCDFRVKGSWLERSCVVYAGESDAIVAQMHRKHTVQSVFLGKDNFSVTVYPNVDYAFIASLVVILDDV 210          
The following BLAST results are available for this feature:
BLAST of CX295705 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y5175_ARATH6.522e-6761.96UPF0706 protein At5g01750 OS=Arabidopsis thaliana ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05075A07SK DroRLeaf1 Citrus clementina cDNA clone C05075A07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295705 ID=CX295705; Name=CX295705; organism=Citrus clementina; type=EST; length=710bp
TCGTATCATATCATGGAGCAACCAATTACACAACACACTGCAGACCAGAT
GCCACAGCAACCAAACCCACAGCAAATTCCACAGCAGCCAATTAATATTC
CAGCGCCAACTCCAGCACCAACAATATATTCCAATCCGGTTTCGGTAATC
GGCCCTCAGTATTGCCTTCCTTATCCCGTTGATCTATCCATCGTTAGAAA
GTTTTTAACCCTCACCGATGGCAGTTTTGCTGTCACTGATATCAATGACA
ATCTCATGTTCAAAGTGAAAGAAAAACTTATAAGCCTCCATGACAAGCGG
ACTCTACTTGATCCTGCTGGCAACCCTATTGTCACCATAACAGAGAAAGT
TTTTTCCTTGCACGAGAAGCATTTTGTATTCAGGGGGGCTAGCACAGACA
CTAAAGATCTTCTCTTTACTGTGGAAAGATCTTCAGTGATCCAATTGAAG
ACCACTTTGAACGTCTACCTGGCAAGTAACACCAAACAAGATGTTTGCGA
TTTCAAGATCAAAGGCAGCTGGACTGAAAAATCTTGTGTTGTATATGCTG
GAGAGTCAAACACAATTGTTGCCCAGATGCACAAAAAGACAACTGCGGGC
AGTGTCTTGCTCAACAAGGACAGGTTCACTGTGACAGTTTATCCGAACAT
AGACTATGCGTTTATAGTAGCCCTGATCGTGATCCTCGATGATATCACGG
TGATGATGAT
back to top