CX295711
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX295711 vs. ExPASy Swiss-Prot
Match: AKT2_ARATH (Potassium channel AKT2/3 OS=Arabidopsis thaliana GN=AKT2 PE=1 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 1.490e-13 Identity = 34/52 (65.38%), Postives = 42/52 (80.77%), Query Frame = 3 Query: 3 GNKKAALSYSLLGILRFWRLRRVKQLFTRLEKDIRFNYFWIRCIKLLFVSTF 158 G ++ +LLG+LRFWRLRRVK LFTRLEKDIR++YFWIRC +LL V+ F Sbjct: 174 GTSTLNITCNLLGLLRFWRLRRVKHLFTRLEKDIRYSYFWIRCFRLLSVTLF 225
BLAST of CX295711 vs. ExPASy Swiss-Prot
Match: KAT1_ARATH (Potassium channel KAT1 OS=Arabidopsis thaliana GN=KAT1 PE=1 SV=2) HSP 1 Score: 70.8626 bits (172), Expect = 8.178e-12 Identity = 31/46 (67.39%), Postives = 36/46 (78.26%), Query Frame = 3 Query: 21 LSYSLLGILRFWRLRRVKQLFTRLEKDIRFNYFWIRCIKLLFVSTF 158 L + +L +LR WRLRRV LF RLEKDIRFNYFWIRC KL+ V+ F Sbjct: 162 LGFRILSMLRLWRLRRVSSLFARLEKDIRFNYFWIRCTKLISVTLF 207
BLAST of CX295711 vs. ExPASy Swiss-Prot
Match: KAT2_ARATH (Potassium channel KAT2 OS=Arabidopsis thaliana GN=KAT2 PE=1 SV=2) HSP 1 Score: 67.781 bits (164), Expect = 6.923e-11 Identity = 29/46 (63.04%), Postives = 35/46 (76.09%), Query Frame = 3 Query: 21 LSYSLLGILRFWRLRRVKQLFTRLEKDIRFNYFWIRCIKLLFVSTF 158 + + +L +LR WRLRRV LF RLEKDIRFNYFW RC KL+ V+ F Sbjct: 173 IGFRVLSMLRLWRLRRVSSLFARLEKDIRFNYFWTRCTKLISVTLF 218 The following BLAST results are available for this feature:
BLAST of CX295711 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX295711 ID=CX295711; Name=CX295711; organism=Citrus clementina; type=EST; length=732bpback to top |