CX295726

Overview
NameCX295726
Unique NameCX295726
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length714
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX295726 vs. ExPASy Swiss-Prot
Match: AAT3_ARATH (Aspartate aminotransferase, chloroplastic OS=Arabidopsis thaliana GN=ASP3 PE=1 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 4.286e-119
Identity = 201/231 (87.01%), Postives = 223/231 (96.54%), Query Frame = 2
Query:    2 AYRTEEGKPLVLNVVRKAEQQLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEFLARHYHQRTIYIPQPTWGNHPKVFTLAGLSVKSYRYYDPATRGLNFQGLLEDLGSAPAGAIVLLHACAHNPTGVDPTLQQWERIRQLMRSKGLLPFFDSAYQGFASGSLDSDAQSVRMFVADGGECFIAQSYXKNLGLYGERVGALSIVCR 694
            AYRTEEGKPLVLNVVRKAEQQL+NDR+R+KEYLPIVGL EFNKLSAKLILGADSPAIRENR+TTV+CLSGTGSLRVG EFLA+HYHQ+TIYI QPTWGNHPK+FTLAGL+VK+YRYYDPATRGLNFQGLLEDLG+A  G+IVLLHACAHNPTGVDPT+QQWE+IR+LMRSKGL+PFFDSAYQGFASGSLD+DA+ +RMFVADGGEC +AQSY KN+GLYGERVGALSIVC+
Sbjct:   82 AYRTEEGKPLVLNVVRKAEQQLINDRTRIKEYLPIVGLVEFNKLSAKLILGADSPAIRENRITTVECLSGTGSLRVGGEFLAKHYHQKTIYITQPTWGNHPKIFTLAGLTVKTYRYYDPATRGLNFQGLLEDLGAAAPGSIVLLHACAHNPTGVDPTIQQWEQIRKLMRSKGLMPFFDSAYQGFASGSLDTDAKPIRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCK 312          
BLAST of CX295726 vs. ExPASy Swiss-Prot
Match: AATC_ORYSJ (Aspartate aminotransferase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os01g0760600 PE=2 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.379e-117
Identity = 205/230 (89.13%), Postives = 218/230 (94.78%), Query Frame = 2
Query:    2 AYRTEEGKPLVLNVVRKAEQQLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEFLARHYHQRTIYIPQPTWGNHPKVFTLAGLSVKSYRYYDPATRGLNFQGLLEDLGSAPAGAIVLLHACAHNPTGVDPTLQQWERIRQLMRSKGLLPFFDSAYQGFASGSLDSDAQSVRMFVADGGECFIAQSYXKNLGLYGERVGALSIVC 691
            AYRTEEGKPLVLNVVR+AEQ L+N+ SRVKEYLPI GLA+FNKLSAKLI GADSPAI+ENRV TVQCLSGTGSLRVG EFLARHYH+RTIYIPQPTWGNHPKVFTLAGL+V+SYRYYDPATRGL+FQGLLEDLGSAP+GAIVLLHACAHNPTGVDPTL QWE+IRQLMRSK LLPFFDSAYQGFASGSLD DAQSVRMFVADGGE  +AQSY KN+GLYGERVGALSIVC
Sbjct:   40 AYRTEEGKPLVLNVVRRAEQMLINNPSRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHYHERTIYIPQPTWGNHPKVFTLAGLTVRSYRYYDPATRGLDFQGLLEDLGSAPSGAIVLLHACAHNPTGVDPTLDQWEQIRQLMRSKALLPFFDSAYQGFASGSLDQDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVC 269          
BLAST of CX295726 vs. ExPASy Swiss-Prot
Match: AATC_DAUCA (Aspartate aminotransferase, cytoplasmic OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 1.801e-117
Identity = 201/231 (87.01%), Postives = 220/231 (95.24%), Query Frame = 2
Query:    2 AYRTEEGKPLVLNVVRKAEQQLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEFLARHYHQRTIYIPQPTWGNHPKVFTLAGLSVKSYRYYDPATRGLNFQGLLEDLGSAPAGAIVLLHACAHNPTGVDPTLQQWERIRQLMRSKGLLPFFDSAYQGFASGSLDSDAQSVRMFVADGGECFIAQSYXKNLGLYGERVGALSIVCR 694
            AYRTEEGKPLVLNVV+KAEQ LVND+SRVKEYLPIVGLA+FNKLSAKLI GADSPAI+ENRV TVQCLSGTGSLRVG EFLARHYH+ T+YIPQPTWGNHPK+FTLAGLSVK+YRYY+P TRGL+F+G+LEDLGSAP GAIVLLHACAHNPTGVDPT++QWE+IRQLMRSK LLPFFDSAYQGFASGSLD+DAQSVR+FVADGGEC  AQSY KN+GLYGERVGALSIVC+
Sbjct:   38 AYRTEEGKPLVLNVVKKAEQMLVNDQSRVKEYLPIVGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHYHEHTVYIPQPTWGNHPKIFTLAGLSVKTYRYYNPETRGLDFEGMLEDLGSAPLGAIVLLHACAHNPTGVDPTIEQWEQIRQLMRSKSLLPFFDSAYQGFASGSLDADAQSVRIFVADGGECLAAQSYAKNMGLYGERVGALSIVCK 268          
BLAST of CX295726 vs. ExPASy Swiss-Prot
Match: AAT2_ARATH (Aspartate aminotransferase, cytoplasmic isozyme 1 OS=Arabidopsis thaliana GN=ASP2 PE=1 SV=2)

HSP 1 Score: 412.535 bits (1059), Expect = 1.093e-114
Identity = 200/231 (86.58%), Postives = 218/231 (94.37%), Query Frame = 2
Query:    2 AYRTEEGKPLVLNVVRKAEQQLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEFLARHYHQRTIYIPQPTWGNHPKVFTLAGLSVKSYRYYDPATRGLNFQGLLEDLGSAPAGAIVLLHACAHNPTGVDPTLQQWERIRQLMRSKGLLPFFDSAYQGFASGSLDSDAQSVRMFVADGGECFIAQSYXKNLGLYGERVGALSIVCR 694
            AYRTEEGKPLVL+VVRKAEQQLVND SRVKEY+PIVG+++FNKLSAKLILGADSPAI E+RVTTVQCLSGTGSLRVGAEFL  HYHQ  IYIP+PTWGNHPKVF LAGLSV+ +RYYDPATRGL+F+GLLEDLG+AP+GAIVLLHACAHNPTGVDPT +QWE+IRQLMRSK LLPFFDSAYQGFASGSLD+DAQSVR FVADGGEC IAQSY KN+GLYGERVGALSIVC+
Sbjct:   38 AYRTEEGKPLVLDVVRKAEQQLVNDPSRVKEYIPIVGISDFNKLSAKLILGADSPAITESRVTTVQCLSGTGSLRVGAEFLKTHYHQSVIYIPKPTWGNHPKVFNLAGLSVEYFRYYDPATRGLDFKGLLEDLGAAPSGAIVLLHACAHNPTGVDPTSEQWEQIRQLMRSKSLLPFFDSAYQGFASGSLDTDAQSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCK 268          
BLAST of CX295726 vs. ExPASy Swiss-Prot
Match: AAT1_MEDSA (Aspartate aminotransferase 1 OS=Medicago sativa GN=AAT-1 PE=2 SV=2)

HSP 1 Score: 395.201 bits (1014), Expect = 1.805e-109
Identity = 191/231 (82.68%), Postives = 214/231 (92.64%), Query Frame = 2
Query:    2 AYRTEEGKPLVLNVVRKAEQQLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEFLARHYHQRTIYIPQPTWGNHPKVFTLAGLSVKSYRYYDPATRGLNFQGLLEDLGSAPAGAIVLLHACAHNPTGVDPTLQQWERIRQLMRSKGLLPFFDSAYQGFASGSLDSDAQSVRMFVADGGECFIAQSYXKNLGLYGERVGALSIVCR 694
            AYRTEEGKPLVL+VVR+ E+QL+ND SR KEY+PIVGLA+FNKLSAKLI GADSPAI+ENRVTTVQ LSGTGSLRVG EFLA+HYHQR IY+P PTWGNH KVF LAGL+VK+YRYY PATRGL+FQGLLEDLGSAP+G++VLLHACAHNPTGVDPTL+QWE+IRQL+RSK LLPFFDSAYQGFASGSLD+DAQ VR+FVADGGE  +AQSY KN+GLYGERVGALSIV +
Sbjct:   51 AYRTEEGKPLVLDVVRRVERQLLNDMSRNKEYIPIVGLADFNKLSAKLIFGADSPAIQENRVTTVQGLSGTGSLRVGGEFLAKHYHQRIIYLPTPTWGNHTKVFNLAGLTVKTYRYYAPATRGLDFQGLLEDLGSAPSGSVVLLHACAHNPTGVDPTLEQWEQIRQLIRSKSLLPFFDSAYQGFASGSLDADAQPVRLFVADGGELLVAQSYAKNMGLYGERVGALSIVSK 281          
BLAST of CX295726 vs. ExPASy Swiss-Prot
Match: AAT4_ARATH (Aspartate aminotransferase, cytoplasmic isozyme 2 OS=Arabidopsis thaliana GN=ASP4 PE=2 SV=2)

HSP 1 Score: 370.163 bits (949), Expect = 6.218e-102
Identity = 176/229 (76.86%), Postives = 204/229 (89.08%), Query Frame = 2
Query:    5 YRTEEGKPLVLNVVRKAEQQLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEFLARHYHQRTIYIPQPTWGNHPKVFTLAGLSVKSYRYYDPATRGLNFQGLLEDLGSAPAGAIVLLHACAHNPTGVDPTLQQWERIRQLMRSKGLLPFFDSAYQGFASGSLDSDAQSVRMFVADGGECFIAQSYXKNLGLYGERVGALSIVC 691
            YRTEEGKPLVL+VVR+AEQQL ND    KEYLP+ GL EFNKLS KLILG DSPA++ENRV T QCLSGTGSLRVGAEFLA H  +  I++P PTWGNHP++FTLAGLSV+ +RYYDP +RGL+F+G+LEDLG+AP GAIV+L ACAHNPTGVDPT +QWE+IR+L+RSK LLPFFDSAYQGFASGSLD+DAQ+VRMFVADGGEC IAQSY KN+GLYGER+G+L+IVC
Sbjct:   39 YRTEEGKPLVLDVVRRAEQQLANDLD--KEYLPLNGLPEFNKLSTKLILGDDSPALKENRVVTTQCLSGTGSLRVGAEFLATHNKESVIFVPNPTWGNHPRIFTLAGLSVQYFRYYDPKSRGLDFKGMLEDLGAAPPGAIVVLQACAHNPTGVDPTFEQWEKIRRLVRSKSLLPFFDSAYQGFASGSLDADAQAVRMFVADGGECLIAQSYAKNMGLYGERIGSLTIVC 265          
BLAST of CX295726 vs. ExPASy Swiss-Prot
Match: AATM_LUPAN (Aspartate aminotransferase P2, mitochondrial (Fragment) OS=Lupinus angustifolius PE=2 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 7.164e-74
Identity = 135/229 (58.95%), Postives = 172/229 (75.11%), Query Frame = 2
Query:    2 AYRTEEGKPLVLNVVRKAEQQLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEFLARHYHQRTIYIPQPTWGNHPKVFTLAGLSVKSYRYYDPATRGLNFQGLLEDLGSAPAGAIVLLHACAHNPTGVDPTLQQWERIRQLMRSKGLLPFFDSAYQGFASGSLDSDAQSVRMFVADGGECFIAQSYXKNLGLYGERVGALSIV 688
            AYRTEE +P VL VV KAE  L+ +R + KEYL I GLA FNK +A+L+LGAD+PAI++ RV TVQ LSGTGSLR+GA  + R++    + I  PTWGNH  +F  A +    YRYYDP T GL+F+G++ED+ +AP G  VLLH CAHNPTG+DPT +QWE+I  +++ K  +PFFD AYQGFASGSLD DA SVR+FVA G E  +AQSY KNLGLY ER+GA++++
Sbjct:   87 AYRTEELQPYVLKVVNKAEN-LMLERGQNKEYLAIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAALIERYFPGAKVLISAPTWGNHKNIFNDARVPWSEYRYYDPKTVGLDFEGMIEDIKAAPEGTFVLLHGCAHNPTGIDPTPEQWEKIADVIQEKNHIPFFDVAYQGFASGSLDEDAASVRLFVARGLEVLVAQSYSKNLGLYAERIGAINVI 314          
BLAST of CX295726 vs. ExPASy Swiss-Prot
Match: AAT5_ARATH (Aspartate aminotransferase, chloroplastic OS=Arabidopsis thaliana GN=ASP5 PE=1 SV=2)

HSP 1 Score: 271.552 bits (693), Expect = 3.010e-72
Identity = 131/230 (56.96%), Postives = 167/230 (72.61%), Query Frame = 2
Query:    2 AYRTEEGKPLVLNVVRKAEQQLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEFLARHYHQRTIYIPQPTWGNHPKVFTLAGLSVKSYRYYDPATRGLNFQGLLEDLGSAPAGAIVLLHACAHNPTGVDPTLQQWERIRQLMRSKGLLPFFDSAYQGFASGSLDSDAQSVRMFVADGGECFIAQSYXKNLGLYGERVGALSIVC 691
            AYRTEE +P VLNVV+KAE  L+ +R   KEYLPI GLA FNK +A+L+ GA  P I+E RV T+Q LSGTGSLR+ A  + R++    + I  PTWGNH  +F  A +    YRYYDP T GL+F+G++ D+  AP G+ +LLH CAHNPTG+DPT +QW +I  +++ K  +PFFD AYQGFASGSLD DA SVR+F   G E F+AQSY KNLGLY ER+GA+++VC
Sbjct:   86 AYRTEELQPYVLNVVKKAEN-LMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTGSLRLAAALIERYFPGAKVVISSPTWGNHKNIFNDAKVPWSEYRYYDPKTIGLDFEGMIADIKEAPEGSFILLHGCAHNPTGIDPTPEQWVKIADVIQEKNHIPFFDVAYQGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVC 314          
BLAST of CX295726 vs. ExPASy Swiss-Prot
Match: AATC_BOVIN (Aspartate aminotransferase, cytoplasmic OS=Bos taurus GN=GOT1 PE=1 SV=3)

HSP 1 Score: 270.781 bits (691), Expect = 5.134e-72
Identity = 134/238 (56.30%), Postives = 172/238 (72.27%), Query Frame = 2
Query:    2 AYRTEEGKPLVLNVVRKAEQQLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEFLARHYH-----QRTIYIPQPTWGNHPKVFTLAGLS-VKSYRYYDPATRGLNFQGLLEDLGSAPAGAIVLLHACAHNPTGVDPTLQQWERIRQLMRSKGLLPFFDSAYQGFASGSLDSDAQSVRMFVADGGECFIAQSYXKNLGLYGERVGALSIVCRQ 697
            AYRT++ +P VL VVRK EQ++ ND S   EYLPI+GLAEF   +++L LG DSPA++E RV  VQCL GTG+LR+GAEFLAR Y+        +Y+  PTW NH  VF  AG   ++SY Y+D A RGL+ QG L DL  AP  +I +LHACAHNPTG DPT +QW++I  +M+ + L PFFDSAYQGFASGSL+ DA ++R FV++G E F AQS+ KN GLY ERVG L++V ++
Sbjct:   40 AYRTDDSQPWVLPVVRKVEQRIANDSSINHEYLPILGLAEFRTCASRLALGDDSPALQEKRVGGVQCLGGTGALRIGAEFLARWYNGTNNKDTPVYVSSPTWENHNGVFIAAGFKDIRSYHYWDAAKRGLDLQGFLNDLEKAPEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGSLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKE 277          
BLAST of CX295726 vs. ExPASy Swiss-Prot
Match: AATC_PIG (Aspartate aminotransferase, cytoplasmic OS=Sus scrofa GN=GOT1 PE=1 SV=3)

HSP 1 Score: 267.7 bits (683), Expect = 4.346e-71
Identity = 133/238 (55.88%), Postives = 173/238 (72.69%), Query Frame = 2
Query:    2 AYRTEEGKPLVLNVVRKAEQQLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEFLARHYH-----QRTIYIPQPTWGNHPKVFTLAGLS-VKSYRYYDPATRGLNFQGLLEDLGSAPAGAIVLLHACAHNPTGVDPTLQQWERIRQLMRSKGLLPFFDSAYQGFASGSLDSDAQSVRMFVADGGECFIAQSYXKNLGLYGERVGALSIVCRQ 697
            AYRT++ +P VL VVRK EQ++ ND S   EYLPI+GLAEF   +++L LG DSPA++E RV  VQ L GTG+LR+GAEFLAR Y+        +Y+  PTW NH  VFT AG   ++SYRY+D   RGL+ QG L DL +AP  +I +LHACAHNPTG DPT +QW++I  +M+ + L PFFDSAYQGFASG+L+ DA ++R FV++G E F AQS+ KN GLY ERVG L++V ++
Sbjct:   40 AYRTDDCQPWVLPVVRKVEQRIANDSSLNHEYLPILGLAEFRTCASRLALGDDSPALQEKRVGGVQSLGGTGALRIGAEFLARWYNGTNNKDTPVYVSSPTWENHNGVFTTAGFKDIRSYRYWDTEKRGLDLQGFLSDLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGNLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKE 277          
The following BLAST results are available for this feature:
BLAST of CX295726 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
AAT3_ARATH4.286e-11987.01Aspartate aminotransferase, chloroplastic OS=Arabi... [more]
AATC_ORYSJ1.379e-11789.13Aspartate aminotransferase, cytoplasmic OS=Oryza s... [more]
AATC_DAUCA1.801e-11787.01Aspartate aminotransferase, cytoplasmic OS=Daucus ... [more]
AAT2_ARATH1.093e-11486.58Aspartate aminotransferase, cytoplasmic isozyme 1 ... [more]
AAT1_MEDSA1.805e-10982.68Aspartate aminotransferase 1 OS=Medicago sativa GN... [more]
AAT4_ARATH6.218e-10276.86Aspartate aminotransferase, cytoplasmic isozyme 2 ... [more]
AATM_LUPAN7.164e-7458.95Aspartate aminotransferase P2, mitochondrial (Frag... [more]
AAT5_ARATH3.010e-7256.96Aspartate aminotransferase, chloroplastic OS=Arabi... [more]
AATC_BOVIN5.134e-7256.30Aspartate aminotransferase, cytoplasmic OS=Bos tau... [more]
AATC_PIG4.346e-7155.88Aspartate aminotransferase, cytoplasmic OS=Sus scr... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05075C04SK DroRLeaf1 Citrus clementina cDNA clone C05075C04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295726 ID=CX295726; Name=CX295726; organism=Citrus clementina; type=EST; length=714bp
TGCTTATCGAACTGAGGAAGGCAAGCCTTTGGTTTTGAATGTTGTGAGAA
AAGCGGAGCAGCAGCTTGTTAATGACAGGTCCCGTGTTAAGGAATATCTT
CCTATTGTTGGATTGGCTGAATTCAATAAATTGAGTGCTAAGCTCATTTT
GGGTGCTGACAGCCCTGCTATCCGAGAGAATCGAGTTACTACAGTTCAGT
GCTTGTCCGGTACTGGTTCTTTGAGAGTTGGAGCTGAATTTTTGGCTAGA
CATTATCATCAACGCACAATATACATTCCCCAGCCAACATGGGGAAACCA
CCCGAAAGTTTTCACTTTGGCTGGACTATCTGTGAAATCTTACCGTTACT
ATGATCCCGCAACACGTGGTCTTAACTTCCAAGGCTTGTTGGAAGACCTT
GGTTCTGCCCCAGCTGGTGCTATTGTGCTCCTCCATGCATGTGCTCACAA
CCCCACTGGTGTGGATCCCACTCTTCAGCAGTGGGAACGAATCAGGCAGC
TGATGAGATCTAAGGGGTTGCTACCTTTTTTTGATAGTGCTTATCAGGGT
TTTGCAAGTGGAAGTCTGGATTCAGATGCACAATCTGTTCGCATGTTTGT
TGCTGATGGTGGTGAATGCTTTATAGCTCAAAGTTATGNCAAGAACTTGG
GGCTTTATGGGGAACGTGTTGGGGCTCTAAGCATTGTCTGCAGACAGCTG
ATGTGGCAGGCAGG
back to top