CX295731

Overview
NameCX295731
Unique NameCX295731
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length690
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX295731 vs. ExPASy Swiss-Prot
Match: TCP1A_TOBAC (Two pore calcium channel protein 1A OS=Nicotiana tabacum GN=TPC1A PE=2 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 5.967e-86
Identity = 144/192 (75.00%), Postives = 161/192 (83.85%), Query Frame = 1
Query:    1 EEVEFVSGWIYVLEMALKIYSYGFENYWRDGQNRFDFLVTWVIVIGETITLASPNGQTFLSNGEWIXXXXXXXXXXXXXXXMHVQQYRGFVATFLTLIPSLMPYLGTIFCVQCIYCSLGVQIFGGIVNAGNAKLEETDLADDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMQSYKELTGTAWTLAYFVSFY 576
            ++VEF  GW+YV+EMALK+Y+YGFENYWRDGQNRFDF+VTWVIVIGET T  +P+G TFLSNGEWI               MHV++YR FVATF TLIPSL+PYLGTIFC+ C YCSLG+QIFGGIVN GN  L +TDLA +DYLLFNFNDYPNGMVTLFN+LVMGNWQVWMQSYKELTGTAWT AYFVSFY
Sbjct:  468 QKVEFTFGWLYVIEMALKVYTYGFENYWRDGQNRFDFVVTWVIVIGETATFVAPDGLTFLSNGEWIRYLLIARMLRLIRLLMHVERYRAFVATFFTLIPSLVPYLGTIFCILCFYCSLGLQIFGGIVNTGNPNLAQTDLAGNDYLLFNFNDYPNGMVTLFNILVMGNWQVWMQSYKELTGTAWTYAYFVSFY 659          
BLAST of CX295731 vs. ExPASy Swiss-Prot
Match: TPC1B_TOBAC (Two pore calcium channel protein 1B OS=Nicotiana tabacum GN=TPC1B PE=2 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 7.794e-86
Identity = 144/192 (75.00%), Postives = 161/192 (83.85%), Query Frame = 1
Query:    1 EEVEFVSGWIYVLEMALKIYSYGFENYWRDGQNRFDFLVTWVIVIGETITLASPNGQTFLSNGEWIXXXXXXXXXXXXXXXMHVQQYRGFVATFLTLIPSLMPYLGTIFCVQCIYCSLGVQIFGGIVNAGNAKLEETDLADDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMQSYKELTGTAWTLAYFVSFY 576
            ++VEF  GW+YV+EMALK+Y+YGFENYWRDGQNRFDF+VTWVIVIGET T  +P+  TFLSNGEWI               MHV++YR FVATFLTLIPSLMPYLGTIFC+ C YCSLG+QIFGGIVN GN  L +TDLA +DYLLFNFNDYPNGMVTLFN+LVMGNWQVWMQSYKELTGT+WT AYFVSFY
Sbjct:  468 QKVEFTFGWLYVIEMALKVYTYGFENYWRDGQNRFDFIVTWVIVIGETTTFVAPDDLTFLSNGEWIRYLLIARMLRLIRLLMHVERYRAFVATFLTLIPSLMPYLGTIFCILCFYCSLGLQIFGGIVNTGNPNLAQTDLAGNDYLLFNFNDYPNGMVTLFNILVMGNWQVWMQSYKELTGTSWTYAYFVSFY 659          
BLAST of CX295731 vs. ExPASy Swiss-Prot
Match: TPC1_ARATH (Two pore calcium channel protein 1 OS=Arabidopsis thaliana GN=TPC1 PE=1 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 6.598e-85
Identity = 147/209 (70.33%), Postives = 164/209 (78.47%), Query Frame = 1
Query:   10 EFVSGWIYVLEMALKIYSYGFENYWRDGQNRFDFLVTWVIVIGETITLASPNGQTFLSNGEWIXXXXXXXXXXXXXXXMHVQQYRGFVATFLTLIPSLMPYLGTIFCVQCIYCSLGVQIFGGIVNAGNAKLEETDLADDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMQSYKELTGTAWTLAYFVSFYXXXXXXXXXXXXXXXXEAFF 636
            EFV GWIYVLEMALKIY+YGFENYWR+G NRFDFLVTWVIVIGET T  +P+  TF SNGEWI               M+VQ+YR F+ATF+TLIPSLMPYLGTIFCV CIYCS+GVQ+FGG+VNAGN KL ET+LA+DDYLLFNFNDYPNGMVTLFNLLVMGNWQVWM+SYK+LTGT W++ YFVSFY                EAFF
Sbjct:  468 EFVFGWIYVLEMALKIYTYGFENYWREGANRFDFLVTWVIVIGETATFITPDENTFFSNGEWIRYLLLARMLRLIRLLMNVQRYRAFIATFITLIPSLMPYLGTIFCVLCIYCSIGVQVFGGLVNAGNKKLFETELAEDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMESYKDLTGTWWSITYFVSFYVITILLLLNLVVAFVLEAFF 676          
BLAST of CX295731 vs. ExPASy Swiss-Prot
Match: TPC1_WHEAT (Two pore calcium channel protein 1 OS=Triticum aestivum GN=TPC1 PE=2 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.056e-74
Identity = 133/213 (62.44%), Postives = 156/213 (73.24%), Query Frame = 1
Query:    1 EEVEFVSGWIYVLEMALKIYSYGFENYWRDGQNRFDFLVTWVIVIGETITLASPNGQTFLSNGEWIXXXXXXXXXXXXXXXMHVQQYRGFVATFLTLIPSLMPYLGTIFCVQCIYCSLGVQIFGGIVNAGNAKLEETDLADDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMQSYKELTGTAWTLAYFVSFYXXXXXXXXXXXXXXXXEAFFA 639
            +EVEF  GWIYV EMALKI+S GF  YW +GQN+FDF++TW I IGET+T A P+   FLSNGEWI               + VQ++R FVATF TL+ SLMPYLG +FCV C+YCS+G+QIFGGIV AGN  LEETDL ++DYLLFNFNDYP+GMVTLFNLLVMGNWQVWM+SY +LTGT+W+L YFVSFY                EAFFA
Sbjct:  477 QEVEFFLGWIYVAEMALKIFSLGFGAYWMEGQNKFDFVLTWTIFIGETLTFAFPSKLPFLSNGEWIRYLLLGRVLRLTRILLQVQRFRAFVATFFTLMSSLMPYLGIVFCVLCMYCSIGLQIFGGIVYAGNPTLEETDLFNNDYLLFNFNDYPSGMVTLFNLLVMGNWQVWMESYWQLTGTSWSLIYFVSFYLISILLLLNLIVAFVLEAFFA 689          
BLAST of CX295731 vs. ExPASy Swiss-Prot
Match: TPC1_ORYSJ (Two pore calcium channel protein 1 OS=Oryza sativa subsp. japonica GN=TPC1 PE=1 SV=2)

HSP 1 Score: 279.641 bits (714), Expect = 1.056e-74
Identity = 132/213 (61.97%), Postives = 156/213 (73.24%), Query Frame = 1
Query:    1 EEVEFVSGWIYVLEMALKIYSYGFENYWRDGQNRFDFLVTWVIVIGETITLASPNGQTFLSNGEWIXXXXXXXXXXXXXXXMHVQQYRGFVATFLTLIPSLMPYLGTIFCVQCIYCSLGVQIFGGIVNAGNAKLEETDLADDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMQSYKELTGTAWTLAYFVSFYXXXXXXXXXXXXXXXXEAFFA 639
            +EVEFV GWIYV+EMALKI+S GF  YW +GQN+FDF++TW I IGET+T A P+  +FLSNGEWI               + V+++R FVATF TL+ SLMPYLG +FC  CIYCSLG+QIFGGIV AGN  LEETDL  +DYLLFNFNDYP+GMVTLFNLLVMGNWQ WM+SY++LTG+ W+L YFVSFY                EAFFA
Sbjct:  490 QEVEFVFGWIYVIEMALKIFSLGFGAYWMEGQNKFDFVLTWTIFIGETLTFAFPSKLSFLSNGEWIRYLLLGRMLRLTRILLQVRRFRAFVATFFTLMSSLMPYLGIVFCTLCIYCSLGLQIFGGIVYAGNPTLEETDLFSNDYLLFNFNDYPSGMVTLFNLLVMGNWQAWMESYRQLTGSYWSLIYFVSFYLISVLLLLNLIVAFVLEAFFA 702          
BLAST of CX295731 vs. ExPASy Swiss-Prot
Match: TPC1_HORVU (Two pore calcium channel protein 1 OS=Hordeum vulgare GN=TPC1 PE=2 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 6.843e-74
Identity = 132/213 (61.97%), Postives = 155/213 (72.77%), Query Frame = 1
Query:    1 EEVEFVSGWIYVLEMALKIYSYGFENYWRDGQNRFDFLVTWVIVIGETITLASPNGQTFLSNGEWIXXXXXXXXXXXXXXXMHVQQYRGFVATFLTLIPSLMPYLGTIFCVQCIYCSLGVQIFGGIVNAGNAKLEETDLADDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMQSYKELTGTAWTLAYFVSFYXXXXXXXXXXXXXXXXEAFFA 639
            +EVEF  GWIYV EMALKI+S GF  YW +GQN+FDF++TW I IGET+T A P+   FLSNGEWI               + VQ++R FVATF TL+ SLMPYLG +FC+ C+YCSLG+QIFGGIV AGN  LEETDL  +DYLLFNFNDYP+GMVTLFNLLVMGNWQVWM+SY +LTG++W+L YFVSFY                EAFFA
Sbjct:  477 QEVEFFLGWIYVAEMALKIFSLGFGAYWMEGQNKFDFVLTWTIFIGETLTFAFPSKLPFLSNGEWIRYLLLGRVLRLTRILLQVQRFRVFVATFFTLMSSLMPYLGIVFCILCMYCSLGLQIFGGIVYAGNPTLEETDLFSNDYLLFNFNDYPSGMVTLFNLLVMGNWQVWMESYWQLTGSSWSLIYFVSFYLISILLLLNLIVAFVLEAFFA 689          
BLAST of CX295731 vs. ExPASy Swiss-Prot
Match: TPC2_MOUSE (Two pore calcium channel protein 2 OS=Mus musculus GN=Tpcn2 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.773e-13
Identity = 52/199 (26.13%), Postives = 91/199 (45.73%), Query Frame = 1
Query:   31 YVLEMALKIYSYGFENYWRDGQNRFDFLVTWVIVIGETITLA---------SPNGQTFLSNGEWIXXXXXXXXXXXXXXXMHVQQYRGFVATFLTLIPSLMPYLGTIFCVQCIYCSLGVQIFGG-IVNAGNAKLEETD-------LADDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMQSYKELTGTAWTLAYFVSFY 576
            Y+LE+  K+++ G   Y     N FD L+T ++++ E  TLA          P     LS  +                  +++       T L LIP+L  + G +     ++  +G+ +F G IV  GN+ L   +            Y   NF+D+   ++TL+N++V+ NWQV +++YK   G  W++ YFV ++
Sbjct:  464 YLLELLFKVFALGLPGYLSYHSNVFDGLLTIILLVSEICTLAVYRLPHSGWKPEQYGPLSLWDMTRLMNTLIVFRFLRIIPNIKPMAEVANTILGLIPNLRAFGGILVVAYYVFAMIGINLFRGVIVPPGNSSLVPDNNSAVCGSFEQLGYWPNNFDDFAAALITLWNVMVVNNWQVILEAYKRYAG-PWSMVYFVLWW 661          
The following BLAST results are available for this feature:
BLAST of CX295731 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
TCP1A_TOBAC5.967e-8675.00Two pore calcium channel protein 1A OS=Nicotiana t... [more]
TPC1B_TOBAC7.794e-8675.00Two pore calcium channel protein 1B OS=Nicotiana t... [more]
TPC1_ARATH6.598e-8570.33Two pore calcium channel protein 1 OS=Arabidopsis ... [more]
TPC1_WHEAT1.056e-7462.44Two pore calcium channel protein 1 OS=Triticum aes... [more]
TPC1_ORYSJ1.056e-7461.97Two pore calcium channel protein 1 OS=Oryza sativa... [more]
TPC1_HORVU6.843e-7461.97Two pore calcium channel protein 1 OS=Hordeum vulg... [more]
TPC2_MOUSE1.773e-1326.13Two pore calcium channel protein 2 OS=Mus musculus... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05075C09SK DroRLeaf1 Citrus clementina cDNA clone C05075C09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295731 ID=CX295731|Name=CX295731|organism=Citrus clementina|type=EST|length=690bp
GAGGAGGTGGAGTTTGTCTCTGGGTGGATATATGTACTGGAAATGGCTCT
GAAAATTTATTCATATGGATTTGAGAATTATTGGAGGGATGGTCAAAATC
GCTTCGATTTTCTGGTCACATGGGTGATAGTTATTGGAGAAACTATAACT
CTTGCTTCACCTAACGGACAGACTTTCCTTTCAAATGGAGAATGGATTCG
CTACCTTCTTCTTGCAAGAATGTTAAGATTGATCAGGCTCCTAATGCACG
TCCAACAATACCGAGGATTTGTCGCTACATTCTTAACTCTCATACCTAGT
TTAATGCCATACCTTGGGACCATCTTTTGTGTCCAATGCATCTATTGCTC
TCTTGGTGTACAGATCTTTGGCGGGATTGTCAATGCTGGGAATGCCAAGT
TAGAAGAGACAGATCTTGCTGATGATGATTATTTACTTTTTAATTTTAAT
GACTATCCAAATGGAATGGTGACACTTTTCAATTTGCTCGTCATGGGAAA
TTGGCAAGTTTGGATGCAGAGCTACAAAGAGTTGACAGGAACTGCTTGGA
CTCTAGCATATTTCGTCAGCTTCTACCTAATAACTGTTTTACTACTATTG
AATTTGGTCATAGCTTTTGTCTTGGAGGCATTCTTTGCCGAAATGGAACT
CGAGAGTTCAGAGAAATGTGAAGAAGAGGACAAGGATGGG
back to top