CX295732

Overview
NameCX295732
Unique NameCX295732
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length768
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12086 contig Ccv1_Contig12086:104..871. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX295732 vs. ExPASy Swiss-Prot
Match: COGT2_ARATH (Cytokinin-O-glucosyltransferase 2 OS=Arabidopsis thaliana GN=UGT85A1 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 5.424e-33
Identity = 85/251 (33.86%), Postives = 136/251 (54.18%), Query Frame = 1
Query:   40 HVAILPLPAVGHVNSMLNLAELLGHAGIKITFLNTEHYYDRVIRHSSDAFSRYMQIPGFQFKTITDGLPRDHPRTPDKFPELVDSL--NCATP--PLLKEM-VSDSNSPVNCIITDGYMSRAIDAAREVGISIIYFRTISACAFWSFHCIPDIIDAGELPIKGTEDM------DRLITTVPGMEGFLRCRDLPSFCRVNDPMDPQLLLFARETRLSAHADGLILNTFEDLEGPILSQSATLMADIYSIGLL 759
            HV  +P PA GH+N M+ +A+LL   G  +TF+NT + ++R +R  S   +    +P F+F++I DGLP            L +S   NC  P   LL+ +   D+  PV+CI++DG MS  +D A E+G+  + F T S CAF ++      I+ G  P+K    +      D +I  +P M+  ++ +D+PSF R  +P D  +    RET  +  A  +ILNTF+DLE  ++    +++  +YS+G L
Sbjct:   13 HVVCVPYPAQGHINPMMRVAKLLHARGFYVTFVNTVYNHNRFLR--SRGSNALDGLPSFRFESIADGLPETDMDATQDITALCESTMKNCLAPFRELLQRINAGDNVPPVSCIVSDGCMSFTLDVAEELGVPEVLFWTTSGCAFLAYLHFYLFIEKGLCPLKDESYLTKEYLEDTVIDFIPTMKN-VKLKDIPSFIRTTNPDDVMISFALRETERAKRASAIILNTFDDLEHDVVHAMQSILPPVYSVGPL 260          
BLAST of CX295732 vs. ExPASy Swiss-Prot
Match: HMNGT_SORBI (Cyanohydrin beta-glucosyltransferase OS=Sorghum bicolor GN=UGT85B1 PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.996e-27
Identity = 83/256 (32.42%), Postives = 128/256 (50.00%), Query Frame = 1
Query:   40 HVAILPLPAVGHVNSMLNLAELLGHAGIKITFLNTEHYYDRVIRHSSDAFSRYMQIPG--FQFKTITDGLPRDHPRTPDKFPELVDSL--NCATP------PLLKEMVSDSNSPVNCIITDGYMSRAIDAAREVGISIIYFRTISACAFWSFHCIPDIIDAGELPIKGT------EDMDRLITTVPGMEGFLRCRDLPSFCRVNDPMDPQLLLFARETRLSAHADGLILNTFEDLEGPILSQSATLMADIYSIGLL 759
            HV ++P P  GHV  ++ LA LL   G ++TF+ T++ Y R++R   +A  R        F+ + I DGL    P+  +    LVDSL  NC  P       L +E+      PV C++ D  M+ A  AARE GI  + F T SAC    +    ++++ G +P +        + +D  +  VPGM   +R RD+P+FCR  DP D  +    ++   +A +  LILNT  +LE  ++   A     IY++G L
Sbjct:   12 HVVLVPFPGQGHVAPLMQLARLLHARGARVTFVYTQYNYRRLLRAKGEAAVRPPATSSARFRIEVIDDGLSLSVPQ--NDVGGLVDSLRKNCLHPFRALLRRLGQEVEGQDAPPVTCVVGDVVMTFAAAAAREAGIPEVQFFTASACGLLGYLHYGELVERGLVPFRDASLLADDDYLDTPLEWVPGMS-HMRLRDMPTFCRTTDPDDVMVSATLQQMESAAGSKALILNTLYELEKDVVDALAAFFPPIYTVGPL 264          
The following BLAST results are available for this feature:
BLAST of CX295732 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
COGT2_ARATH5.424e-3333.86Cytokinin-O-glucosyltransferase 2 OS=Arabidopsis t... [more]
HMNGT_SORBI1.996e-2732.42Cyanohydrin beta-glucosyltransferase OS=Sorghum bi... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05075C10SK DroRLeaf1 Citrus clementina cDNA clone C05075C10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295732 ID=CX295732|Name=CX295732|organism=Citrus clementina|type=EST|length=768bp
GATTCGGCCGAGGCAGAGATGGAGAAGCAGGATCATGTTCATGTTGCGAT
ACTCCCGCTTCCAGCCGTAGGCCATGTCAACTCCATGCTGAACCTTGCAG
AGCTGCTCGGCCACGCCGGCATCAAGATTACGTTTCTCAACACCGAACAT
TATTACGATCGCGTCATCCGTCACAGCAGTGATGCCTTTTCGCGTTACAT
GCAAATTCCGGGATTTCAATTCAAGACCATAACAGATGGACTTCCCAGGG
ATCATCCTCGAACTCCAGATAAATTCCCTGAGCTTGTTGATTCATTGAAC
TGCGCCACTCCACCCCTTTTGAAAGAGATGGTCAGTGATTCTAATTCGCC
GGTGAACTGTATTATCACAGATGGGTATATGAGCCGTGCAATTGACGCTG
CCAGAGAAGTTGGAATTTCCATTATTTATTTTCGCACTATTAGTGCTTGT
GCATTTTGGTCATTCCATTGCATCCCTGATATCATCGATGCAGGCGAGCT
TCCGATCAAAGGAACTGAAGACATGGATCGCCTGATAACCACTGTACCTG
GAATGGAAGGTTTTCTCAGGTGCCGTGATCTTCCGAGCTTCTGTCGAGTT
AACGACCCAATGGATCCGCAACTCCTACTCTTTGCACGCGAGACCCGATT
ATCTGCTCATGCAGACGGTCTCATATTGAATACATTTGAAGATCTGGAAG
GACCCATCTTGTCCCAATCCGCAACACTCATGGCCGATATCTACAGCATT
GGACTCTTATGCTCATCT
back to top