CX295733

Overview
NameCX295733
Unique NameCX295733
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length650
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig6443 contig Ccv1_Contig6443:880..1529. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX295733 vs. ExPASy Swiss-Prot
Match: XYL1_ARATH (Alpha-xylosidase OS=Arabidopsis thaliana GN=XYL1 PE=1 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 4.041e-118
Identity = 188/216 (87.04%), Postives = 200/216 (92.59%), Query Frame = 3
Query:    3 GGVFDFYFFAGPSPLAVVDQYTAFIGRPAPMPYWSLGFHQCRWGYHNLSVVEDVVENYKKAKIPLDVIWNDDDHMDGHKDFTLNPTNYPRPKLLAFLEKIHKIGMKYIVIIDPGIGVNSSYGVYQRGIANDVFIKYEGEPYLAQVWPGAVNFPDFLNPKTVSWWGDEIRRFHELVPVDGLWIDMNEASNFCSGLCKIPKGKQCPTGTGPGWVCCLD 650
            GGVFDFYF AGPSPL VVDQYT  IGRPAPMPYWSLGFHQCRWGYHNLSVVEDVV+NYKKAKIPLDVIWNDDDHMDGHKDFTLNP  YPR KLLAFL+KIHKIGMKYIVI DPGIGVN+SYG +QR +A DVFIKYEG+P+LAQVWPG V FPDFLNPKTVSWWGDEI+RFH+LVP+DGLWIDMNE SNFCSGLC IP+GKQCP+G GPGWVCCLD
Sbjct:  258 GGVFDFYFIAGPSPLNVVDQYTQLIGRPAPMPYWSLGFHQCRWGYHNLSVVEDVVDNYKKAKIPLDVIWNDDDHMDGHKDFTLNPVAYPRAKLLAFLDKIHKIGMKYIVINDPGIGVNASYGTFQRAMAADVFIKYEGKPFLAQVWPGPVYFPDFLNPKTVSWWGDEIKRFHDLVPIDGLWIDMNEVSNFCSGLCTIPEGKQCPSGEGPGWVCCLD 473          
BLAST of CX295733 vs. ExPASy Swiss-Prot
Match: AGLU_ORYSJ (Probable alpha-glucosidase Os06g0675700 OS=Oryza sativa subsp. japonica GN=Os06g0675700 PE=1 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 3.352e-72
Identity = 116/190 (61.05%), Postives = 147/190 (77.37%), Query Frame = 3
Query:    3 GGVFDFYFFAGPSPLAVVDQYTAFIGRPAPMPYWSLGFHQCRWGYHNLSVVEDVVENYKKAKIPLDVIWNDDDHMDGHKDFTLNPTNYPRPKLLAFLEKIHKIGMKYIVIIDPGIGVNSSYGVYQRGIANDVFIKYEGEPYLAQVWPGAVNFPDFLNPKTVSWWGDEIRRFHELVPVDGLWIDMNEASNF 572
            GGV DFYFFAGPSPLAVVDQYT  IGRPAPMPYWS GFHQCR+GY N++ +E VV  Y KA+IPL+V+W D D+MD +KDFTL+P N+P  ++  F++++H+ G K++VIIDPGI VN++YG + RG+  D+F+K+ G  YL  VWPG V FPDFLNP+   +W  EI  F   +PVDGLW+DMNE SNF
Sbjct:  261 GGVLDFYFFAGPSPLAVVDQYTQLIGRPAPMPYWSFGFHQCRYGYKNVADLEGVVAGYAKARIPLEVMWTDIDYMDAYKDFTLDPVNFPADRMRPFVDRLHRNGQKFVVIIDPGINVNTTYGTFVRGMKQDIFLKWNGSNYLGVVWPGNVYFPDFLNPRAAEFWAREIAAFRRTLPVDGLWVDMNEISNF 450          
BLAST of CX295733 vs. ExPASy Swiss-Prot
Match: AGLU_SPIOL (Alpha-glucosidase OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 4.097e-70
Identity = 115/192 (59.90%), Postives = 145/192 (75.52%), Query Frame = 3
Query:    3 GGVFDFYFFAGPSPLAVVDQYTAFIGRPAPMPYWSLGFHQCRWGYHNLSVVEDVVENYKKAKIPLDVIWNDDDHMDGHKDFTLNPTNYPRPKLLAFLEKIHKIGMKYIVIIDPGIGVNSSYGVYQRGIANDVFIKYEGEPYLAQVWPGAVNFPDFLNPKTVSWWGDEIRRFHELVPVDGLWIDMNEASNFCS 578
            GG+ D YFFAGPSP  VV+Q+T  IGRPAPMPYW+ GF QCR+GYH++  ++ VV  Y KAKIPL+V+W D D+MD +KDFTL+P N+P  K+  F+  +HK G KY+VI+DPGI  N +Y  Y RG+ +DVF+K  G+PYL  VWPG V FPDFL P  +++W DEI+RF  L+PVDGLWIDMNE SNF S
Sbjct:  283 GGIIDLYFFAGPSPGQVVEQFTRVIGRPAPMPYWAFGFQQCRYGYHDVYELQSVVAGYAKAKIPLEVMWTDIDYMDAYKDFTLDPVNFPLDKMKKFVNNLHKNGQKYVVILDPGISTNKTYETYIRGMKHDVFLKRNGKPYLGSVWPGPVYFPDFLKPSALTFWTDEIKRFLNLLPVDGLWIDMNEISNFIS 474          
BLAST of CX295733 vs. ExPASy Swiss-Prot
Match: AGLU_BETVU (Alpha-glucosidase OS=Beta vulgaris PE=1 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 2.248e-68
Identity = 108/190 (56.84%), Postives = 145/190 (76.32%), Query Frame = 3
Query:    3 GGVFDFYFFAGPSPLAVVDQYTAFIGRPAPMPYWSLGFHQCRWGYHNLSVVEDVVENYKKAKIPLDVIWNDDDHMDGHKDFTLNPTNYPRPKLLAFLEKIHKIGMKYIVIIDPGIGVNSSYGVYQRGIANDVFIKYEGEPYLAQVWPGAVNFPDFLNPKTVSWWGDEIRRFHELVPVDGLWIDMNEASNF 572
            GG+ D Y FAG +P  V+DQYT  IGRPAPMPYW+ GFHQCRWGY +++ +E VV+ Y +A+IPL+V+W D D+MD  KDFTL+P ++P  K+  F+ K+H+ G +Y+ I+DPGI  N SYG + RG+ ++VFIK  G PYL  VWPG V +PDFL+P   S+W DEI+RF +++P+DG+WIDMNEASNF
Sbjct:  287 GGIIDLYIFAGRTPEMVLDQYTKLIGRPAPMPYWAFGFHQCRWGYRDVNEIETVVDKYAEARIPLEVMWTDIDYMDAFKDFTLDPVHFPLDKMQQFVTKLHRNGQRYVPILDPGINTNKSYGTFIRGMQSNVFIKRNGNPYLGSVWPGPVYYPDFLDPAARSFWVDEIKRFRDILPIDGIWIDMNEASNF 476          
BLAST of CX295733 vs. ExPASy Swiss-Prot
Match: AGLU_HORVU (Alpha-glucosidase OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 2.572e-64
Identity = 109/193 (56.48%), Postives = 141/193 (73.06%), Query Frame = 3
Query:    3 GGVFDFYFFAGPSPLAVVDQYTAFIGRPAPMPYWSLGFHQCRWGYHNLSVVEDVVENYKKAKIPLDVIWNDDDHMDGHKDFTLNPTNYPRPKLLAFLEKIHKIGMKYIVIIDPGIGV---NSSYGVYQRGIANDVFIKYEGEPYLAQVWPGAVNFPDFLNPKTVSWWGDEIRRFHELVPVDGLWIDMNEASNF 572
            GGV DFYFFAGP+PLAVVDQYT  I RPAPMPYWS GFHQCR+GY N+S +E VV  Y KA+IPL+V+W D D+MDG KDFTL+  N+   +L  F++++H+   KY++I+DPGI V   +++YG + RG+  D+F+K  G  ++  VWPG V FPDF++P    +W  EI  F   +PVDGLWIDMNE SNF
Sbjct:  252 GGVLDFYFFAGPNPLAVVDQYTQLIARPAPMPYWSFGFHQCRYGYLNVSDLERVVARYAKARIPLEVMWTDIDYMDGFKDFTLDRVNFTAAELRPFVDRLHRNAQKYVLILDPGIRVDPIDATYGTFVRGMQQDIFLKRNGTNFVGNVWPGDVYFPDFMHPAAAEFWAREISLFRRTIPVDGLWIDMNEISNF 444          
BLAST of CX295733 vs. ExPASy Swiss-Prot
Match: LYAG_BOVIN (Lysosomal alpha-glucosidase OS=Bos taurus GN=GAA PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 2.950e-52
Identity = 95/197 (48.22%), Postives = 121/197 (61.42%), Query Frame = 3
Query:    3 GGVFDFYFFAGPSPLAVVDQYTAFIGRPAPMPYWSLGFHQCRWGYHNLSVVEDVVENYKKAKIPLDVIWNDDDHMDGHKDFTLNPTNYPRPKLLAFLEKIHKIGMKYIVIIDPGI---GVNSSYGVYQRGIANDVFIKYE-GEPYLAQVWPGAVNFPDFLNPKTVSWWGDEIRRFHELVPVDGLWIDMNEASNFCSG 581
            GG+ D Y F GP P +VV QY   +G P   PYW LGFH CRWGY   ++   VVEN  +A  PLDV WND D+MD  +DFT N  ++      A ++++H+ G +YI+I+DP I   G   +Y  Y  G+   VFI  E G+P + QVWPG   FPDF NP+T+ WW D +  FH  VP DG+WIDMNE SNF  G
Sbjct:  321 GGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSTSAITRQVVENMTRAYFPLDVQWNDLDYMDARRDFTFNKDHF--GDFPAMVQELHQGGRRYIMIVDPAISSSGPAGTYRPYDEGLRRGVFITNETGQPLIGQVWPGLTAFPDFTNPETLDWWQDMVTEFHAQVPFDGMWIDMNEPSNFVRG 515          
BLAST of CX295733 vs. ExPASy Swiss-Prot
Match: LYAG_HUMAN (Lysosomal alpha-glucosidase OS=Homo sapiens GN=GAA PE=1 SV=3)

HSP 1 Score: 203.756 bits (517), Expect = 6.572e-52
Identity = 93/197 (47.21%), Postives = 122/197 (61.93%), Query Frame = 3
Query:    3 GGVFDFYFFAGPSPLAVVDQYTAFIGRPAPMPYWSLGFHQCRWGYHNLSVVEDVVENYKKAKIPLDVIWNDDDHMDGHKDFTLNPTNYPRPKLLAFLEKIHKIGMKYIVIIDPGI---GVNSSYGVYQRGIANDVFIKYE-GEPYLAQVWPGAVNFPDFLNPKTVSWWGDEIRRFHELVPVDGLWIDMNEASNFCSG 581
            GG+ D Y F GP P +VV QY   +G P   PYW LGFH CRWGY + ++   VVEN  +A  PLDV WND D+MD  +DFT N   +      A ++++H+ G +Y++I+DP I   G   SY  Y  G+   VFI  E G+P + +VWPG+  FPDF NP  ++WW D +  FH+ VP DG+WIDMNE SNF  G
Sbjct:  334 GGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGF--RDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRG 528          
BLAST of CX295733 vs. ExPASy Swiss-Prot
Match: LYAG_RAT (Lysosomal alpha-glucosidase OS=Rattus norvegicus GN=Gaa PE=2 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 2.497e-51
Identity = 93/197 (47.21%), Postives = 120/197 (60.91%), Query Frame = 3
Query:    3 GGVFDFYFFAGPSPLAVVDQYTAFIGRPAPMPYWSLGFHQCRWGYHNLSVVEDVVENYKKAKIPLDVIWNDDDHMDGHKDFTLNPTNYPRPKLLAFLEKIHKIGMKYIVIIDPGI---GVNSSYGVYQRGIANDVFIKYE-GEPYLAQVWPGAVNFPDFLNPKTVSWWGDEIRRFHELVPVDGLWIDMNEASNFCSG 581
            GG+ D Y F GP P +VV QY   +G P   PYW LGFH CRWGY + ++V  VVEN  +   PLDV WND D+MD  +DFT N   +        + ++H+ G +Y++I+DP I   G   SY  Y  G+   VFI  E G+P + +VWPG+  FPDF NP+T+ WW D +  FH  VP DG+WIDMNE SNF  G
Sbjct:  334 GGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDGF--ADFPDMVHELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWIDMNEPSNFIRG 528          
BLAST of CX295733 vs. ExPASy Swiss-Prot
Match: LYAG_MOUSE (Lysosomal alpha-glucosidase OS=Mus musculus GN=Gaa PE=1 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 3.262e-51
Identity = 92/197 (46.70%), Postives = 120/197 (60.91%), Query Frame = 3
Query:    3 GGVFDFYFFAGPSPLAVVDQYTAFIGRPAPMPYWSLGFHQCRWGYHNLSVVEDVVENYKKAKIPLDVIWNDDDHMDGHKDFTLNPTNYPRPKLLAFLEKIHKIGMKYIVIIDPGI---GVNSSYGVYQRGIANDVFIKYE-GEPYLAQVWPGAVNFPDFLNPKTVSWWGDEIRRFHELVPVDGLWIDMNEASNFCSG 581
            GG+ D Y F GP P +VV QY   +G P   PYW LGFH CRWGY + ++V  VVEN  +   PLDV WND D+MD  +DFT N  ++        + ++H+ G +Y++I+DP I   G   SY  Y  G+   VFI  E G+P + +VWPG   FPDF NP+T+ WW D +  FH  VP DG+W+DMNE SNF  G
Sbjct:  334 GGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDSF--ADFPDMVRELHQDGRRYMMIVDPAISSAGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWLDMNEPSNFVRG 528          
BLAST of CX295733 vs. ExPASy Swiss-Prot
Match: AMYG_CANAL (Glucoamylase 1 OS=Candida albicans GN=GAM1 PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 4.260e-51
Identity = 92/202 (45.54%), Postives = 122/202 (60.40%), Query Frame = 3
Query:    6 GVFDFYFFAGPSPLAVVDQYTAFIGRPAPMPYWSLGFHQCRWGYHNLSVVEDVVENYKKAKIPLDVIWNDDDHMDGHKDFTLNPTNYPRPKLLAFLEKIHKIGMKYIVIID-------PGIGVNSSYGVYQRGIANDVFIKY-EGEPYLAQVWPGAVNFPDFLNPKTVSWWGDEIRRFHELVPVDGLWIDMNEASNFCSGLC 587
            GV D YFF+GP P  V+ QY + IG PA  PYW+LG+HQCRWGY  +  +E VVEN+KK  IPL+ IW+D D+MDG+KDFT +P  +P  K   FL+ +H     Y+ I D       P    +  Y  +  G  +DVF+K  +G  Y+  VWPG   FPDFL   T  +W    + ++E +P DG+W DMNE S+FC G C
Sbjct:  273 GVIDLYFFSGPDPKDVIQQYVSEIGLPAMQPYWALGYHQCRWGYDTVESLETVVENFKKFDIPLETIWSDIDYMDGYKDFTNDPYRFPTDKFRKFLDDLHNNSQHYVPIFDAAIYVPNPNNATDDDYEPFHLGNESDVFLKNPDGSLYIGAVWPGYTVFPDFLANNTQEYWNKMFKDWYERIPFDGIWTDMNEVSSFCVGSC 474          
The following BLAST results are available for this feature:
BLAST of CX295733 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
XYL1_ARATH4.041e-11887.04Alpha-xylosidase OS=Arabidopsis thaliana GN=XYL1 P... [more]
AGLU_ORYSJ3.352e-7261.05Probable alpha-glucosidase Os06g0675700 OS=Oryza s... [more]
AGLU_SPIOL4.097e-7059.90Alpha-glucosidase OS=Spinacia oleracea PE=1 SV=1[more]
AGLU_BETVU2.248e-6856.84Alpha-glucosidase OS=Beta vulgaris PE=1 SV=1[more]
AGLU_HORVU2.572e-6456.48Alpha-glucosidase OS=Hordeum vulgare PE=2 SV=1[more]
LYAG_BOVIN2.950e-5248.22Lysosomal alpha-glucosidase OS=Bos taurus GN=GAA P... [more]
LYAG_HUMAN6.572e-5247.21Lysosomal alpha-glucosidase OS=Homo sapiens GN=GAA... [more]
LYAG_RAT2.497e-5147.21Lysosomal alpha-glucosidase OS=Rattus norvegicus G... [more]
LYAG_MOUSE3.262e-5146.70Lysosomal alpha-glucosidase OS=Mus musculus GN=Gaa... [more]
AMYG_CANAL4.260e-5145.54Glucoamylase 1 OS=Candida albicans GN=GAM1 PE=1 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05075C11SK DroRLeaf1 Citrus clementina cDNA clone C05075C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295733 ID=CX295733|Name=CX295733|organism=Citrus clementina|type=EST|length=650bp
TTGGGGGTGTTTTCGACTTTTACTTCTTCGCTGGGCCTTCACCGCTTGCT
GTTGTTGATCAGTATACAGCATTTATTGGGAGGCCTGCTCCTATGCCTTA
CTGGTCTCTAGGATTCCACCAGTGCAGATGGGGTTACCATAACCTGTCTG
TGGTCGAAGATGTTGTTGAGAACTACAAGAAGGCTAAAATTCCACTTGAT
GTGATCTGGAATGATGATGATCACATGGACGGACACAAGGATTTCACTCT
CAATCCTACCAACTATCCTCGTCCGAAGCTTTTGGCATTCCTTGAAAAAA
TACATAAAATAGGCATGAAATACATTGTCATTATTGACCCTGGAATTGGA
GTAAATTCTAGCTATGGTGTGTATCAAAGAGGTATAGCGAATGATGTTTT
CATCAAGTATGAGGGTGAACCCTACTTGGCTCAAGTTTGGCCTGGGGCTG
TCAATTTTCCTGACTTCCTCAATCCAAAAACCGTTTCATGGTGGGGTGAT
GAAATTCGCCGCTTTCATGAACTTGTCCCTGTAGATGGCTTGTGGATTGA
CATGAATGAAGCTTCAAATTTCTGTTCTGGACTTTGCAAAATACCTAAGG
GCAAGCAATGTCCAACTGGGACTGGACCCGGTTGGGTCTGTTGCTTGGAC
back to top